Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 6486..7623 | Replicon | plasmid pJXZ076-poxtA-19K |
Accession | NZ_CP117507 | ||
Organism | Enterococcus faecalis strain CQJXZ21-076 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | - |
Locus tag | PSC77_RS14855 | Protein ID | WP_100185210.1 |
Coordinates | 6486..7349 (-) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | R2XCR7 |
Locus tag | PSC77_RS14860 | Protein ID | WP_000301765.1 |
Coordinates | 7351..7623 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PSC77_RS14820 (PSC77_14820) | 1663..2325 | - | 663 | WP_001092058.1 | class I SAM-dependent methyltransferase | - |
PSC77_RS14825 (PSC77_14825) | 2716..3447 | + | 732 | WP_002360844.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(A) | - |
PSC77_RS14830 (PSC77_14830) | 3572..4354 | - | 783 | WP_216468638.1 | aminoglycoside nucleotidyltransferase ANT(9) | - |
PSC77_RS14835 (PSC77_14835) | 4505..4711 | - | 207 | Protein_5 | acyltransferase | - |
PSC77_RS14840 (PSC77_14840) | 4785..5465 | + | 681 | WP_013646119.1 | IS6-like element IS1216 family transposase | - |
PSC77_RS14845 (PSC77_14845) | 5521..5709 | - | 189 | Protein_7 | DnaJ domain-containing protein | - |
PSC77_RS14850 (PSC77_14850) | 5729..6046 | - | 318 | WP_002338433.1 | hypothetical protein | - |
PSC77_RS14855 (PSC77_14855) | 6486..7349 | - | 864 | WP_100185210.1 | zeta toxin family protein | Toxin |
PSC77_RS14860 (PSC77_14860) | 7351..7623 | - | 273 | WP_000301765.1 | antitoxin | Antitoxin |
PSC77_RS14865 (PSC77_14865) | 7640..7855 | - | 216 | WP_002295735.1 | peptide-binding protein | - |
PSC77_RS14870 (PSC77_14870) | 7954..8850 | - | 897 | WP_002304405.1 | ParA family protein | - |
PSC77_RS14875 (PSC77_14875) | 8925..11069 | - | 2145 | WP_225001404.1 | type IA DNA topoisomerase | - |
PSC77_RS14880 (PSC77_14880) | 11069..11686 | - | 618 | WP_002295591.1 | recombinase family protein | - |
PSC77_RS14885 (PSC77_14885) | 11700..11870 | - | 171 | WP_000713595.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | erm(A) / ant(9)-Ia / Cfr(D) / poxtA | - | 1..19987 | 19987 | |
- | flank | IS/Tn | erm(A) / ant(9)-Ia | - | 2716..5465 | 2749 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32416.95 Da Isoelectric Point: 6.6610
>T271265 WP_100185210.1 NZ_CP117507:c7349-6486 [Enterococcus faecalis]
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAILEETQGNVIVIDNDTFKQQHPNFDELA
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMLQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGL
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAILEETQGNVIVIDNDTFKQQHPNFDELA
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMLQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGL
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|