271264

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) omega-epsilon-zeta/zeta-epsilon
Location 79367..80504 Replicon plasmid pJXZ076-85K
Accession NZ_CP117505
Organism Enterococcus faecalis strain CQJXZ21-076

Toxin (Protein)


Gene name zeta Uniprot ID P0A4M2
Locus tag PSC77_RS14615 Protein ID WP_002332783.1
Coordinates 79367..80230 (-) Length 288 a.a.

Antitoxin (Protein)


Gene name epsilon Uniprot ID Q9AL19
Locus tag PSC77_RS14620 Protein ID WP_002326825.1
Coordinates 80232..80504 (-) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PSC77_RS14565 (PSC77_14565) 74461..74853 - 393 WP_000393259.1 GNAT family N-acetyltransferase -
PSC77_RS14570 (PSC77_14570) 74872..74982 - 111 Protein_84 aminoglycoside 6-adenylyltransferase -
PSC77_RS14575 (PSC77_14575) 75001..75117 - 117 Protein_85 topoisomerase DNA-binding C4 zinc finger domain-containing protein -
PSC77_RS14580 (PSC77_14580) 75287..76024 - 738 WP_002292226.1 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) -
PSC77_RS14585 (PSC77_14585) 76149..76232 - 84 WP_001814874.1 23S rRNA methyltransferase attenuation leader peptide -
PSC77_RS14590 (PSC77_14590) 76355..76522 - 168 Protein_88 peptide-binding protein -
PSC77_RS14595 (PSC77_14595) 76656..77018 - 363 Protein_89 topoisomerase DNA-binding C4 zinc finger domain-containing protein -
PSC77_RS14600 (PSC77_14600) 77093..77773 + 681 WP_010713944.1 IS6-like element IS1216 family transposase -
PSC77_RS14605 (PSC77_14605) 77807..78313 - 507 WP_002415429.1 trimethoprim-resistant dihydrofolate reductase DfrG -
PSC77_RS14610 (PSC77_14610) 78610..78927 - 318 WP_002326830.1 hypothetical protein -
PSC77_RS14615 (PSC77_14615) 79367..80230 - 864 WP_002332783.1 zeta toxin family protein Toxin
PSC77_RS14620 (PSC77_14620) 80232..80504 - 273 WP_002326825.1 antitoxin Antitoxin
PSC77_RS14625 (PSC77_14625) 80522..80737 - 216 WP_001835296.1 peptide-binding protein -
PSC77_RS14630 (PSC77_14630) 80829..81725 - 897 WP_002326827.1 ParA family protein -
PSC77_RS14635 (PSC77_14635) 81828..82088 - 261 Protein_97 topoisomerase DNA-binding C4 zinc finger domain-containing protein -
PSC77_RS14640 (PSC77_14640) 82258..82995 - 738 WP_181710332.1 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) -
PSC77_RS14645 (PSC77_14645) 83120..83203 - 84 WP_001814874.1 23S rRNA methyltransferase attenuation leader peptide -
PSC77_RS14650 (PSC77_14650) 83635..84006 - 372 WP_002358205.1 hypothetical protein -
PSC77_RS14655 (PSC77_14655) 83999..84844 - 846 WP_000239313.1 AAA family ATPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(L) / tet(M) / erm(B) / aph(3')-III / ant(6)-Ia / aac(6')-aph(2'') / dfrG - 1..85315 85315
- inside IS/Tn erm(B) / aph(3')-III / ant(6)-Ia / aac(6')-aph(2'') / dfrG - 69141..82995 13854


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Zeta toxin domain

(28-214)

Antitoxin

Bacterial epsilon antitoxin

(2-90)


Sequences

Toxin        


Download         Length: 288 a.a.        Molecular weight: 32675.27 Da        Isoelectric Point: 7.3939

>T271264 WP_002332783.1 NZ_CP117505:c80230-79367 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI

Download         Length: 864 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 10720.17 Da        Isoelectric Point: 4.4865

>AT271264 WP_002326825.1 NZ_CP117505:c80504-80232 [Enterococcus faecalis]
MAVTYEKTFEIEIINELSASVYNRVLNYVLNHELDTKNTRLLEVNLLNQLEVAQEVDLFQQPFEELQAIHEYWRSMNQYS
KQILTKEKVA

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB P0A4M2

Antitoxin

Source ID Structure
AlphaFold DB A0A0M2AF93

References