Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
| Location | 79367..80504 | Replicon | plasmid pJXZ076-85K |
| Accession | NZ_CP117505 | ||
| Organism | Enterococcus faecalis strain CQJXZ21-076 | ||
Toxin (Protein)
| Gene name | zeta | Uniprot ID | P0A4M2 |
| Locus tag | PSC77_RS14615 | Protein ID | WP_002332783.1 |
| Coordinates | 79367..80230 (-) | Length | 288 a.a. |
Antitoxin (Protein)
| Gene name | epsilon | Uniprot ID | Q9AL19 |
| Locus tag | PSC77_RS14620 | Protein ID | WP_002326825.1 |
| Coordinates | 80232..80504 (-) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PSC77_RS14565 (PSC77_14565) | 74461..74853 | - | 393 | WP_000393259.1 | GNAT family N-acetyltransferase | - |
| PSC77_RS14570 (PSC77_14570) | 74872..74982 | - | 111 | Protein_84 | aminoglycoside 6-adenylyltransferase | - |
| PSC77_RS14575 (PSC77_14575) | 75001..75117 | - | 117 | Protein_85 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
| PSC77_RS14580 (PSC77_14580) | 75287..76024 | - | 738 | WP_002292226.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
| PSC77_RS14585 (PSC77_14585) | 76149..76232 | - | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
| PSC77_RS14590 (PSC77_14590) | 76355..76522 | - | 168 | Protein_88 | peptide-binding protein | - |
| PSC77_RS14595 (PSC77_14595) | 76656..77018 | - | 363 | Protein_89 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
| PSC77_RS14600 (PSC77_14600) | 77093..77773 | + | 681 | WP_010713944.1 | IS6-like element IS1216 family transposase | - |
| PSC77_RS14605 (PSC77_14605) | 77807..78313 | - | 507 | WP_002415429.1 | trimethoprim-resistant dihydrofolate reductase DfrG | - |
| PSC77_RS14610 (PSC77_14610) | 78610..78927 | - | 318 | WP_002326830.1 | hypothetical protein | - |
| PSC77_RS14615 (PSC77_14615) | 79367..80230 | - | 864 | WP_002332783.1 | zeta toxin family protein | Toxin |
| PSC77_RS14620 (PSC77_14620) | 80232..80504 | - | 273 | WP_002326825.1 | antitoxin | Antitoxin |
| PSC77_RS14625 (PSC77_14625) | 80522..80737 | - | 216 | WP_001835296.1 | peptide-binding protein | - |
| PSC77_RS14630 (PSC77_14630) | 80829..81725 | - | 897 | WP_002326827.1 | ParA family protein | - |
| PSC77_RS14635 (PSC77_14635) | 81828..82088 | - | 261 | Protein_97 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
| PSC77_RS14640 (PSC77_14640) | 82258..82995 | - | 738 | WP_181710332.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
| PSC77_RS14645 (PSC77_14645) | 83120..83203 | - | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
| PSC77_RS14650 (PSC77_14650) | 83635..84006 | - | 372 | WP_002358205.1 | hypothetical protein | - |
| PSC77_RS14655 (PSC77_14655) | 83999..84844 | - | 846 | WP_000239313.1 | AAA family ATPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(L) / tet(M) / erm(B) / aph(3')-III / ant(6)-Ia / aac(6')-aph(2'') / dfrG | - | 1..85315 | 85315 | |
| - | inside | IS/Tn | erm(B) / aph(3')-III / ant(6)-Ia / aac(6')-aph(2'') / dfrG | - | 69141..82995 | 13854 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32675.27 Da Isoelectric Point: 7.3939
>T271264 WP_002332783.1 NZ_CP117505:c80230-79367 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | P0A4M2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M2AF93 |