Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 62534..63105 | Replicon | plasmid pJXZ076-85K |
| Accession | NZ_CP117505 | ||
| Organism | Enterococcus faecalis strain CQJXZ21-076 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | S4H3R9 |
| Locus tag | PSC77_RS14465 | Protein ID | WP_010784114.1 |
| Coordinates | 62534..62875 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R3KHK9 |
| Locus tag | PSC77_RS14470 | Protein ID | WP_002362431.1 |
| Coordinates | 62875..63105 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PSC77_RS14440 (PSC77_14440) | 58106..58243 | - | 138 | WP_170965568.1 | hypothetical protein | - |
| PSC77_RS14445 (PSC77_14445) | 58292..58891 | - | 600 | WP_070415749.1 | tyrosine-type recombinase/integrase | - |
| PSC77_RS14455 (PSC77_14455) | 60617..61219 | - | 603 | WP_002362434.1 | Fic family protein | - |
| PSC77_RS14460 (PSC77_14460) | 61484..62422 | - | 939 | WP_002362433.1 | hypothetical protein | - |
| PSC77_RS14465 (PSC77_14465) | 62534..62875 | - | 342 | WP_010784114.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PSC77_RS14470 (PSC77_14470) | 62875..63105 | - | 231 | WP_002362431.1 | hypothetical protein | Antitoxin |
| PSC77_RS14475 (PSC77_14475) | 63309..63929 | + | 621 | WP_002367784.1 | recombinase family protein | - |
| PSC77_RS14480 (PSC77_14480) | 63919..64233 | + | 315 | WP_002367785.1 | hypothetical protein | - |
| PSC77_RS14485 (PSC77_14485) | 64227..64433 | + | 207 | WP_002367786.1 | hypothetical protein | - |
| PSC77_RS14490 (PSC77_14490) | 64593..64787 | + | 195 | WP_002367787.1 | hypothetical protein | - |
| PSC77_RS14495 (PSC77_14495) | 64799..64990 | + | 192 | WP_002367788.1 | hypothetical protein | - |
| PSC77_RS14500 (PSC77_14500) | 65160..65375 | + | 216 | WP_002367791.1 | leucocin A/sakacin P family class II bacteriocin | - |
| PSC77_RS14505 (PSC77_14505) | 65376..65717 | + | 342 | WP_002367792.1 | bacteriocin immunity protein | - |
| PSC77_RS14510 (PSC77_14510) | 66133..66651 | + | 519 | WP_002367793.1 | hypothetical protein | - |
| PSC77_RS14515 (PSC77_14515) | 66599..66814 | + | 216 | WP_002415356.1 | hypothetical protein | - |
| PSC77_RS14520 (PSC77_14520) | 66906..66992 | + | 87 | WP_012881081.1 | type I toxin-antitoxin system Fst family toxin | - |
| PSC77_RS14525 (PSC77_14525) | 67249..67545 | + | 297 | WP_002367795.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(L) / tet(M) / erm(B) / aph(3')-III / ant(6)-Ia / aac(6')-aph(2'') / dfrG | - | 1..85315 | 85315 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13270.47 Da Isoelectric Point: 7.9750
>T271263 WP_010784114.1 NZ_CP117505:c62875-62534 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEYLPLKDMAKIDQIIEYIF
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEYLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|