271263

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 62534..63105 Replicon plasmid pJXZ076-85K
Accession NZ_CP117505
Organism Enterococcus faecalis strain CQJXZ21-076

Toxin (Protein)


Gene name mazF Uniprot ID S4H3R9
Locus tag PSC77_RS14465 Protein ID WP_010784114.1
Coordinates 62534..62875 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag PSC77_RS14470 Protein ID WP_002362431.1
Coordinates 62875..63105 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PSC77_RS14440 (PSC77_14440) 58106..58243 - 138 WP_170965568.1 hypothetical protein -
PSC77_RS14445 (PSC77_14445) 58292..58891 - 600 WP_070415749.1 tyrosine-type recombinase/integrase -
PSC77_RS14455 (PSC77_14455) 60617..61219 - 603 WP_002362434.1 Fic family protein -
PSC77_RS14460 (PSC77_14460) 61484..62422 - 939 WP_002362433.1 hypothetical protein -
PSC77_RS14465 (PSC77_14465) 62534..62875 - 342 WP_010784114.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
PSC77_RS14470 (PSC77_14470) 62875..63105 - 231 WP_002362431.1 hypothetical protein Antitoxin
PSC77_RS14475 (PSC77_14475) 63309..63929 + 621 WP_002367784.1 recombinase family protein -
PSC77_RS14480 (PSC77_14480) 63919..64233 + 315 WP_002367785.1 hypothetical protein -
PSC77_RS14485 (PSC77_14485) 64227..64433 + 207 WP_002367786.1 hypothetical protein -
PSC77_RS14490 (PSC77_14490) 64593..64787 + 195 WP_002367787.1 hypothetical protein -
PSC77_RS14495 (PSC77_14495) 64799..64990 + 192 WP_002367788.1 hypothetical protein -
PSC77_RS14500 (PSC77_14500) 65160..65375 + 216 WP_002367791.1 leucocin A/sakacin P family class II bacteriocin -
PSC77_RS14505 (PSC77_14505) 65376..65717 + 342 WP_002367792.1 bacteriocin immunity protein -
PSC77_RS14510 (PSC77_14510) 66133..66651 + 519 WP_002367793.1 hypothetical protein -
PSC77_RS14515 (PSC77_14515) 66599..66814 + 216 WP_002415356.1 hypothetical protein -
PSC77_RS14520 (PSC77_14520) 66906..66992 + 87 WP_012881081.1 type I toxin-antitoxin system Fst family toxin -
PSC77_RS14525 (PSC77_14525) 67249..67545 + 297 WP_002367795.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(L) / tet(M) / erm(B) / aph(3')-III / ant(6)-Ia / aac(6')-aph(2'') / dfrG - 1..85315 85315


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(7-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13270.47 Da        Isoelectric Point: 7.9750

>T271263 WP_010784114.1 NZ_CP117505:c62875-62534 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEYLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT271263 WP_002362431.1 NZ_CP117505:c63105-62875 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S4H3R9

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References