Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 54403..55022 | Replicon | plasmid pJXZ076-99K |
| Accession | NZ_CP117504 | ||
| Organism | Enterococcus faecalis strain CQJXZ21-076 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | R3H4V2 |
| Locus tag | PSC77_RS13910 | Protein ID | WP_000241511.1 |
| Coordinates | 54403..54765 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R3H5D1 |
| Locus tag | PSC77_RS13915 | Protein ID | WP_000245205.1 |
| Coordinates | 54759..55022 (-) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PSC77_RS13895 (PSC77_13895) | 49813..51744 | - | 1932 | WP_010816308.1 | sucrose-specific PTS transporter subunit IIBC | - |
| PSC77_RS13900 (PSC77_13900) | 51935..53374 | + | 1440 | WP_002367771.1 | sucrose-6-phosphate hydrolase | - |
| PSC77_RS13905 (PSC77_13905) | 53376..54338 | + | 963 | WP_002367770.1 | LacI family DNA-binding transcriptional regulator | - |
| PSC77_RS13910 (PSC77_13910) | 54403..54765 | - | 363 | WP_000241511.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PSC77_RS13915 (PSC77_13915) | 54759..55022 | - | 264 | WP_000245205.1 | PbsX family transcriptional regulator | Antitoxin |
| PSC77_RS13920 (PSC77_13920) | 55199..55819 | + | 621 | WP_048941608.1 | recombinase family protein | - |
| PSC77_RS13925 (PSC77_13925) | 55836..56044 | + | 209 | Protein_68 | hypothetical protein | - |
| PSC77_RS13930 (PSC77_13930) | 56041..56967 | + | 927 | WP_010706945.1 | AbiH family protein | - |
| PSC77_RS13935 (PSC77_13935) | 56985..57806 | + | 822 | WP_048941604.1 | DUF5677 domain-containing protein | - |
| PSC77_RS13940 (PSC77_13940) | 58049..58177 | - | 129 | WP_002409262.1 | hypothetical protein | - |
| PSC77_RS13945 (PSC77_13945) | 58270..58521 | + | 252 | WP_002399487.1 | hypothetical protein | - |
| PSC77_RS13950 (PSC77_13950) | 58637..59953 | + | 1317 | WP_010815752.1 | Y-family DNA polymerase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | prgB/asc10 | 1..99966 | 99966 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13585.78 Da Isoelectric Point: 9.6107
>T271262 WP_000241511.1 NZ_CP117504:c54765-54403 [Enterococcus faecalis]
MVKVPHQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVIVAPISSTKRNYPLYVSINPSYGMKTSGKVLLDQLT
TIDYEARQCVFLETAHEKLIDELLLKVRTVFQKVNKTNKF
MVKVPHQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVIVAPISSTKRNYPLYVSINPSYGMKTSGKVLLDQLT
TIDYEARQCVFLETAHEKLIDELLLKVRTVFQKVNKTNKF
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|