Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 33420..33991 Replicon plasmid pJXZ076-99K
Accession NZ_CP117504
Organism Enterococcus faecalis strain CQJXZ21-076

Toxin (Protein)


Gene name mazF Uniprot ID A0A2P6BPI5
Locus tag PSC77_RS13820 Protein ID WP_002394791.1
Coordinates 33650..33991 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag PSC77_RS13815 Protein ID WP_002362431.1
Coordinates 33420..33650 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PSC77_RS13790 (PSC77_13790) 29213..29743 + 531 WP_236304206.1 hypothetical protein -
PSC77_RS13795 (PSC77_13795) 29797..30477 + 681 WP_001015311.1 IS6-like element IS1216 family transposase -
PSC77_RS13800 (PSC77_13800) 30605..31564 + 960 WP_000222577.1 IS30-like element IS1252 family transposase -
PSC77_RS13805 (PSC77_13805) 31997..32569 - 573 WP_000170424.1 recombinase family protein -
PSC77_RS13810 (PSC77_13810) 32585..33190 - 606 WP_000599739.1 Fic family protein -
PSC77_RS13815 (PSC77_13815) 33420..33650 + 231 WP_002362431.1 hypothetical protein Antitoxin
PSC77_RS13820 (PSC77_13820) 33650..33991 + 342 WP_002394791.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
PSC77_RS13825 (PSC77_13825) 34103..35041 + 939 WP_002394789.1 hypothetical protein -
PSC77_RS13830 (PSC77_13830) 35309..35911 + 603 WP_002367780.1 Fic family protein -
PSC77_RS13835 (PSC77_13835) 36145..36825 - 681 WP_002367779.1 IS6 family transposase -
PSC77_RS13840 (PSC77_13840) 37080..38018 + 939 WP_002335374.1 2-dehydropantoate 2-reductase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - prgB/asc10 1..99966 99966
- inside IScluster/Tn - - 26248..46384 20136


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(10-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13248.49 Da        Isoelectric Point: 8.8595

>T271261 WP_002394791.1 NZ_CP117504:33650-33991 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT271261 WP_002362431.1 NZ_CP117504:33420-33650 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P6BPI5

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References