Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 2730450..2731021 | Replicon | chromosome |
Accession | NZ_CP117503 | ||
Organism | Enterococcus faecalis strain CQJXZ21-076 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | PSC77_RS13125 | Protein ID | WP_002354774.1 |
Coordinates | 2730450..2730791 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S4CGQ1 |
Locus tag | PSC77_RS13130 | Protein ID | WP_002367500.1 |
Coordinates | 2730791..2731021 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PSC77_RS13120 (2726465) | 2726465..2730079 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
PSC77_RS13125 (2730450) | 2730450..2730791 | - | 342 | WP_002354774.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PSC77_RS13130 (2730791) | 2730791..2731021 | - | 231 | WP_002367500.1 | hypothetical protein | Antitoxin |
PSC77_RS13135 (2731344) | 2731344..2731559 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
PSC77_RS13140 (2731698) | 2731698..2732690 | + | 993 | WP_002358973.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
PSC77_RS13145 (2732757) | 2732757..2733389 | - | 633 | WP_002358972.1 | RloB family protein | - |
PSC77_RS13150 (2733398) | 2733398..2734693 | - | 1296 | WP_002410675.1 | ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13156.40 Da Isoelectric Point: 9.3984
>T271257 WP_002354774.1 NZ_CP117503:c2730791-2730450 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|