Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 31143..31786 Replicon plasmid unnamed3
Accession NZ_CP117484
Organism Klebsiella pneumoniae strain DS-1

Toxin (Protein)


Gene name vagD Uniprot ID A0A7D6UII7
Locus tag PPH92_RS27480 Protein ID WP_032425563.1
Coordinates 31143..31559 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag PPH92_RS27485 Protein ID WP_001261276.1
Coordinates 31556..31786 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PPH92_RS27460 (PPH92_27460) 26427..27395 + 969 WP_077266288.1 IS5 family transposase -
PPH92_RS27465 (PPH92_27465) 27441..28295 - 855 WP_273857275.1 cysteine peptidase family C39 domain-containing protein -
PPH92_RS27470 (PPH92_27470) 28285..29562 - 1278 WP_009309915.1 HlyD family secretion protein -
PPH92_RS27475 (PPH92_27475) 30224..31102 + 879 WP_009309916.1 restriction endonuclease -
PPH92_RS27480 (PPH92_27480) 31143..31559 - 417 WP_032425563.1 type II toxin-antitoxin system VapC family toxin Toxin
PPH92_RS27485 (PPH92_27485) 31556..31786 - 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PPH92_RS27490 (PPH92_27490) 32383..32601 + 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA -
PPH92_RS27495 (PPH92_27495) 32603..32908 + 306 WP_009309918.1 type II toxin-antitoxin system toxin CcdB -
PPH92_RS27500 (PPH92_27500) 32966..33277 + 312 WP_009309919.1 hypothetical protein -
PPH92_RS27505 (PPH92_27505) 33327..33662 + 336 WP_009309920.1 hypothetical protein -
PPH92_RS27510 (PPH92_27510) 33696..34712 + 1017 WP_009309921.1 hypothetical protein -
PPH92_RS27515 (PPH92_27515) 34910..35689 + 780 WP_023287113.1 site-specific integrase -
PPH92_RS27520 (PPH92_27520) 35747..36004 - 258 WP_009310077.1 hypothetical protein -
PPH92_RS27525 (PPH92_27525) 36133..36246 - 114 WP_014343462.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..85339 85339
- inside IScluster/Tn - - 14777..27395 12618


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15080.56 Da        Isoelectric Point: 8.5403

>T271244 WP_032425563.1 NZ_CP117484:c31559-31143 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT271244 WP_001261276.1 NZ_CP117484:c31786-31556 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7D6UII7

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References