Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 24957..25693 | Replicon | plasmid unnamed3 |
| Accession | NZ_CP117484 | ||
| Organism | Klebsiella pneumoniae strain DS-1 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | J5UJ49 |
| Locus tag | PPH92_RS27445 | Protein ID | WP_009654334.1 |
| Coordinates | 24957..25439 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | PPH92_RS27450 | Protein ID | WP_003026799.1 |
| Coordinates | 25427..25693 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PPH92_RS27435 (PPH92_27435) | 20400..23369 | + | 2970 | WP_024945956.1 | Tn3-like element TnShfr1 family transposase | - |
| PPH92_RS27440 (PPH92_27440) | 23448..24452 | + | 1005 | WP_000427620.1 | IS110-like element IS4321 family transposase | - |
| PPH92_RS27445 (PPH92_27445) | 24957..25439 | - | 483 | WP_009654334.1 | GNAT family N-acetyltransferase | Toxin |
| PPH92_RS27450 (PPH92_27450) | 25427..25693 | - | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| PPH92_RS27455 (PPH92_27455) | 25932..26366 | - | 435 | WP_042928448.1 | cell envelope integrity protein TolA | - |
| PPH92_RS27460 (PPH92_27460) | 26427..27395 | + | 969 | WP_077266288.1 | IS5 family transposase | - |
| PPH92_RS27465 (PPH92_27465) | 27441..28295 | - | 855 | WP_273857275.1 | cysteine peptidase family C39 domain-containing protein | - |
| PPH92_RS27470 (PPH92_27470) | 28285..29562 | - | 1278 | WP_009309915.1 | HlyD family secretion protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..85339 | 85339 | |
| - | inside | IScluster/Tn | - | - | 14777..27395 | 12618 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17339.06 Da Isoelectric Point: 8.7400
>T271243 WP_009654334.1 NZ_CP117484:c25439-24957 [Klebsiella pneumoniae]
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDISLHVKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYVHHGFKASQTHERTLFLKLP
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDISLHVKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYVHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4QCA1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |