Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5198288..5198913 | Replicon | chromosome |
| Accession | NZ_CP117481 | ||
| Organism | Klebsiella pneumoniae strain DS-1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PPH92_RS25315 | Protein ID | WP_111459801.1 |
| Coordinates | 5198288..5198671 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | PPH92_RS25320 | Protein ID | WP_004150355.1 |
| Coordinates | 5198671..5198913 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PPH92_RS25300 (5195654) | 5195654..5196556 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| PPH92_RS25305 (5196553) | 5196553..5197188 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PPH92_RS25310 (5197185) | 5197185..5198114 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| PPH92_RS25315 (5198288) | 5198288..5198671 | - | 384 | WP_111459801.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PPH92_RS25320 (5198671) | 5198671..5198913 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| PPH92_RS25325 (5199118) | 5199118..5200035 | + | 918 | WP_004187175.1 | alpha/beta hydrolase | - |
| PPH92_RS25330 (5200049) | 5200049..5200990 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
| PPH92_RS25335 (5201035) | 5201035..5201472 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
| PPH92_RS25340 (5201469) | 5201469..5202329 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
| PPH92_RS25345 (5202323) | 5202323..5202922 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14359.58 Da Isoelectric Point: 7.3178
>T271241 WP_111459801.1 NZ_CP117481:c5198671-5198288 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWLEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWLEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|