Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4703594..4704110 | Replicon | chromosome |
Accession | NZ_CP117481 | ||
Organism | Klebsiella pneumoniae strain DS-1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A085DK79 |
Locus tag | PPH92_RS22965 | Protein ID | WP_009309309.1 |
Coordinates | 4703594..4703878 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | PPH92_RS22970 | Protein ID | WP_002886901.1 |
Coordinates | 4703868..4704110 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PPH92_RS22940 (4699070) | 4699070..4699333 | - | 264 | WP_228985702.1 | PTS sugar transporter subunit IIB | - |
PPH92_RS22945 (4699463) | 4699463..4699636 | + | 174 | WP_178941634.1 | hypothetical protein | - |
PPH92_RS22950 (4699639) | 4699639..4700382 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
PPH92_RS22955 (4700739) | 4700739..4702877 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
PPH92_RS22960 (4703126) | 4703126..4703590 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
PPH92_RS22965 (4703594) | 4703594..4703878 | - | 285 | WP_009309309.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PPH92_RS22970 (4703868) | 4703868..4704110 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PPH92_RS22975 (4704188) | 4704188..4706098 | - | 1911 | WP_009486549.1 | PRD domain-containing protein | - |
PPH92_RS22980 (4706121) | 4706121..4707275 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
PPH92_RS22985 (4707342) | 4707342..4708082 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11141.99 Da Isoelectric Point: 10.3787
>T271239 WP_009309309.1 NZ_CP117481:c4703878-4703594 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A085DK79 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |