Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
| Location | 4589347..4590157 | Replicon | chromosome |
| Accession | NZ_CP117481 | ||
| Organism | Klebsiella pneumoniae strain DS-1 | ||
Toxin (Protein)
| Gene name | KacT | Uniprot ID | - |
| Locus tag | PPH92_RS22475 | Protein ID | WP_156731902.1 |
| Coordinates | 4589347..4589880 (-) | Length | 178 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | J2E9Q7 |
| Locus tag | PPH92_RS22480 | Protein ID | WP_002887278.1 |
| Coordinates | 4589891..4590157 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PPH92_RS22470 (4588178) | 4588178..4589299 | + | 1122 | WP_156731901.1 | cupin domain-containing protein | - |
| PPH92_RS22475 (4589347) | 4589347..4589880 | - | 534 | WP_156731902.1 | type II toxin-antitoxin system toxin KacT | Toxin |
| PPH92_RS22480 (4589891) | 4589891..4590157 | - | 267 | WP_002887278.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
| PPH92_RS22485 (4590260) | 4590260..4591693 | - | 1434 | WP_156731903.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
| PPH92_RS22490 (4591683) | 4591683..4592366 | - | 684 | WP_004214143.1 | copper response regulator transcription factor CusR | - |
| PPH92_RS22495 (4592538) | 4592538..4593923 | + | 1386 | WP_009484676.1 | efflux transporter outer membrane subunit | - |
| PPH92_RS22500 (4593941) | 4593941..4594285 | + | 345 | WP_065889379.1 | cation efflux system protein CusF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19895.76 Da Isoelectric Point: 5.7068
>T271238 WP_156731902.1 NZ_CP117481:c4589880-4589347 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSRDSVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSRDSVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|