Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3984229..3984848 Replicon chromosome
Accession NZ_CP117481
Organism Klebsiella pneumoniae strain DS-1

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag PPH92_RS19560 Protein ID WP_002892050.1
Coordinates 3984630..3984848 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag PPH92_RS19555 Protein ID WP_002892066.1
Coordinates 3984229..3984603 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PPH92_RS19545 (3979381) 3979381..3980574 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
PPH92_RS19550 (3980597) 3980597..3983743 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
PPH92_RS19555 (3984229) 3984229..3984603 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
PPH92_RS19560 (3984630) 3984630..3984848 + 219 WP_002892050.1 HHA domain-containing protein Toxin
PPH92_RS19565 (3985011) 3985011..3985577 + 567 WP_002892030.1 maltose O-acetyltransferase -
PPH92_RS19570 (3985549) 3985549..3985689 - 141 WP_004147370.1 hypothetical protein -
PPH92_RS19575 (3985710) 3985710..3986180 + 471 WP_002892026.1 YlaC family protein -
PPH92_RS19580 (3986155) 3986155..3987606 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
PPH92_RS19585 (3987707) 3987707..3988405 + 699 WP_025861660.1 GNAT family protein -
PPH92_RS19590 (3988402) 3988402..3988542 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
PPH92_RS19595 (3988542) 3988542..3988805 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T271237 WP_002892050.1 NZ_CP117481:3984630-3984848 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT271237 WP_002892066.1 NZ_CP117481:3984229-3984603 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References