Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3984229..3984848 | Replicon | chromosome |
| Accession | NZ_CP117481 | ||
| Organism | Klebsiella pneumoniae strain DS-1 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | PPH92_RS19560 | Protein ID | WP_002892050.1 |
| Coordinates | 3984630..3984848 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | PPH92_RS19555 | Protein ID | WP_002892066.1 |
| Coordinates | 3984229..3984603 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PPH92_RS19545 (3979381) | 3979381..3980574 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PPH92_RS19550 (3980597) | 3980597..3983743 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| PPH92_RS19555 (3984229) | 3984229..3984603 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| PPH92_RS19560 (3984630) | 3984630..3984848 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| PPH92_RS19565 (3985011) | 3985011..3985577 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| PPH92_RS19570 (3985549) | 3985549..3985689 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| PPH92_RS19575 (3985710) | 3985710..3986180 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| PPH92_RS19580 (3986155) | 3986155..3987606 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
| PPH92_RS19585 (3987707) | 3987707..3988405 | + | 699 | WP_025861660.1 | GNAT family protein | - |
| PPH92_RS19590 (3988402) | 3988402..3988542 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| PPH92_RS19595 (3988542) | 3988542..3988805 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T271237 WP_002892050.1 NZ_CP117481:3984630-3984848 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT271237 WP_002892066.1 NZ_CP117481:3984229-3984603 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |