Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/Tad-HTH_37 |
Location | 17456..18153 | Replicon | plasmid unnamed2 |
Accession | NZ_CP117473 | ||
Organism | Sphingobium sp. YC-XJ3 |
Toxin (Protein)
Gene name | tad | Uniprot ID | T0J3S2 |
Locus tag | PO876_RS26585 | Protein ID | WP_013041565.1 |
Coordinates | 17456..17830 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | T0G937 |
Locus tag | PO876_RS26590 | Protein ID | WP_006964370.1 |
Coordinates | 17827..18153 (+) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PO876_RS26565 (PO876_26565) | 12590..13798 | + | 1209 | WP_011607937.1 | 3-oxoadipyl-CoA thiolase | - |
PO876_RS26570 (PO876_26570) | 14037..14801 | - | 765 | WP_001389365.1 | IS6-like element IS6100 family transposase | - |
PO876_RS26575 (PO876_26575) | 14941..16761 | + | 1821 | Protein_16 | Tn3 family transposase | - |
PO876_RS26580 (PO876_26580) | 16780..17034 | - | 255 | WP_013041563.1 | hypothetical protein | - |
PO876_RS26585 (PO876_26585) | 17456..17830 | + | 375 | WP_013041565.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PO876_RS26590 (PO876_26590) | 17827..18153 | + | 327 | WP_006964370.1 | helix-turn-helix transcriptional regulator | Antitoxin |
PO876_RS26595 (PO876_26595) | 18153..18395 | + | 243 | WP_013041566.1 | hypothetical protein | - |
PO876_RS26600 (PO876_26600) | 18611..19396 | - | 786 | WP_004213209.1 | SDR family NAD(P)-dependent oxidoreductase | - |
PO876_RS26605 (PO876_26605) | 19393..19944 | - | 552 | WP_004213210.1 | recombinase family protein | - |
PO876_RS26610 (PO876_26610) | 20084..23041 | + | 2958 | WP_031286087.1 | Tn3 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..86602 | 86602 | |
- | inside | IScluster/Tn | - | - | 14037..19944 | 5907 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13960.67 Da Isoelectric Point: 9.4885
>T271227 WP_013041565.1 NZ_CP117473:17456-17830 [Sphingobium sp. YC-XJ3]
MDTERPVRWVASSKRDFREFPDDVQDVMGYALHLAQQGGQHASTKPLKGFGGAGVVEIIDDHQGDTFRTVYTVKFAEAVY
VLHAFQKKSKQGKATPQADMDLIRTRLKSAEEHHRQHQTPRGTA
MDTERPVRWVASSKRDFREFPDDVQDVMGYALHLAQQGGQHASTKPLKGFGGAGVVEIIDDHQGDTFRTVYTVKFAEAVY
VLHAFQKKSKQGKATPQADMDLIRTRLKSAEEHHRQHQTPRGTA
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J7XHG4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J8A803 |