Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 111732..112408 Replicon plasmid unnamed1
Accession NZ_CP117472
Organism Sphingobium sp. YC-XJ3

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag PO876_RS25635 Protein ID WP_020818771.1
Coordinates 111732..112145 (-) Length 138 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID T0J953
Locus tag PO876_RS25640 Protein ID WP_020818770.1
Coordinates 112142..112408 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PO876_RS25595 (PO876_25595) 106852..107136 - 285 WP_015460590.1 hypothetical protein -
PO876_RS25600 (PO876_25600) 107148..107843 - 696 WP_015460589.1 hypothetical protein -
PO876_RS25605 (PO876_25605) 108156..108827 + 672 WP_020818773.1 hypothetical protein -
PO876_RS25610 (PO876_25610) 108820..109692 + 873 WP_274054746.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
PO876_RS25615 (PO876_25615) 109832..110137 - 306 WP_015460586.1 hypothetical protein -
PO876_RS25620 (PO876_25620) 110142..110531 - 390 WP_015460585.1 hypothetical protein -
PO876_RS25625 (PO876_25625) 110535..111008 - 474 WP_015460584.1 hypothetical protein -
PO876_RS25630 (PO876_25630) 111005..111523 - 519 WP_020818772.1 hypothetical protein -
PO876_RS25635 (PO876_25635) 111732..112145 - 414 WP_020818771.1 type II toxin-antitoxin system VapC family toxin Toxin
PO876_RS25640 (PO876_25640) 112142..112408 - 267 WP_020818770.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
PO876_RS25645 (PO876_25645) 112600..113064 - 465 WP_020818775.1 DUF736 domain-containing protein -
PO876_RS25650 (PO876_25650) 113289..113840 - 552 WP_020818776.1 hypothetical protein -
PO876_RS25655 (PO876_25655) 114066..114944 - 879 WP_020818777.1 ATP-binding protein -
PO876_RS25660 (PO876_25660) 115029..115124 - 96 Protein_130 DUF3768 domain-containing protein -
PO876_RS25665 (PO876_25665) 115186..116337 + 1152 WP_030538511.1 IS110 family transposase -
PO876_RS25670 (PO876_25670) 116594..116902 - 309 WP_274054748.1 DUF3768 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - htpB 1..284951 284951


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-125)

Antitoxin

SpoVT-AbrB domain

(17-54)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 14585.68 Da        Isoelectric Point: 4.4056

>T271226 WP_020818771.1 NZ_CP117472:c112145-111732 [Sphingobium sp. YC-XJ3]
VSGLYMLDTNTVSELARNPQGSVAARIAEVGPDAICVSIITAAELRYGCARAGSPRLLAQIEAILDSLQILALDVPADTE
YAGIRAELEAAGKPIGPNDWFIAAHAYALEAVLVTANITDFSRIRALKVENWIADLH

Download         Length: 414 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9978.64 Da        Isoelectric Point: 8.7675

>AT271226 WP_020818770.1 NZ_CP117472:c112408-112142 [Sphingobium sp. YC-XJ3]
MARKKAVSVPPREAKLFRNNKSQALRIPADFELPGDRVMIHRDGDRLIIEPVRRKNLLEVLASLQPLGPDDQFPDVEDTL
LPIKAIDL

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A126RG80

References