Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
Location | 9923..10482 | Replicon | plasmid unnamed1 |
Accession | NZ_CP117472 | ||
Organism | Sphingobium sp. YC-XJ3 |
Toxin (Protein)
Gene name | relE | Uniprot ID | T0H6G6 |
Locus tag | PO876_RS25050 | Protein ID | WP_020819388.1 |
Coordinates | 10189..10482 (+) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | T0J1T8 |
Locus tag | PO876_RS25045 | Protein ID | WP_020819389.1 |
Coordinates | 9923..10192 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PO876_RS25040 (PO876_25040) | 6109..9558 | + | 3450 | WP_020819391.1 | YhaN family protein | - |
PO876_RS25045 (PO876_25045) | 9923..10192 | + | 270 | WP_020819389.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
PO876_RS25050 (PO876_25050) | 10189..10482 | + | 294 | WP_020819388.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PO876_RS25055 (PO876_25055) | 10522..10965 | - | 444 | WP_020819387.1 | hypothetical protein | - |
PO876_RS25060 (PO876_25060) | 10962..11810 | - | 849 | WP_066521295.1 | toprim domain-containing protein | - |
PO876_RS25065 (PO876_25065) | 11982..12164 | + | 183 | WP_020819384.1 | hypothetical protein | - |
PO876_RS25070 (PO876_25070) | 12372..13568 | + | 1197 | WP_015460581.1 | AAA family ATPase | - |
PO876_RS25075 (PO876_25075) | 13565..14635 | + | 1071 | WP_025160828.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | htpB | 1..284951 | 284951 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11354.99 Da Isoelectric Point: 7.3579
>T271225 WP_020819388.1 NZ_CP117472:10189-10482 [Sphingobium sp. YC-XJ3]
MKIQWTSKASSDLVRLHEHLGPVAPEAAARVVQQLAHAPDRLIDYPRIGEKLEAYEPREVRRIIVGNYEMRYEIAAGTIF
ILRLWHCRENRNFESEQ
MKIQWTSKASSDLVRLHEHLGPVAPEAAARVVQQLAHAPDRLIDYPRIGEKLEAYEPREVRRIIVGNYEMRYEIAAGTIF
ILRLWHCRENRNFESEQ
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2T4HNW0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2T4HNW7 |