Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 3513200..3513969 | Replicon | chromosome |
| Accession | NZ_CP117471 | ||
| Organism | Sphingobium sp. YC-XJ3 | ||
Toxin (Protein)
| Gene name | TacT3 | Uniprot ID | - |
| Locus tag | PO876_RS17085 | Protein ID | WP_021688186.1 |
| Coordinates | 3513200..3513637 (-) | Length | 146 a.a. |
Antitoxin (Protein)
| Gene name | TacA3 | Uniprot ID | - |
| Locus tag | PO876_RS17090 | Protein ID | WP_021688187.1 |
| Coordinates | 3513724..3513969 (-) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PO876_RS17050 (PO876_17050) | 3508247..3508726 | - | 480 | WP_021688180.1 | hypothetical protein | - |
| PO876_RS17055 (PO876_17055) | 3508732..3509487 | - | 756 | WP_021688181.1 | hypothetical protein | - |
| PO876_RS17060 (PO876_17060) | 3509531..3509992 | - | 462 | WP_021688182.1 | hypothetical protein | - |
| PO876_RS17065 (PO876_17065) | 3510004..3510651 | - | 648 | WP_021688183.1 | hypothetical protein | - |
| PO876_RS17070 (PO876_17070) | 3510725..3510865 | - | 141 | WP_157034366.1 | hypothetical protein | - |
| PO876_RS17075 (PO876_17075) | 3510875..3511978 | - | 1104 | WP_223308141.1 | hypothetical protein | - |
| PO876_RS17080 (PO876_17080) | 3512523..3512864 | - | 342 | WP_021688185.1 | sigma factor-like helix-turn-helix DNA-binding protein | - |
| PO876_RS17085 (PO876_17085) | 3513200..3513637 | - | 438 | WP_021688186.1 | hypothetical protein | Toxin |
| PO876_RS17090 (PO876_17090) | 3513724..3513969 | - | 246 | WP_021688187.1 | DUF1778 domain-containing protein | Antitoxin |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 3493332..3591831 | 98499 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 146 a.a. Molecular weight: 15740.10 Da Isoelectric Point: 9.9035
>T271224 WP_021688186.1 NZ_CP117471:c3513637-3513200 [Sphingobium sp. YC-XJ3]
MRRYARQSHELGGAKTFLAVDDTDNKTILGFYSIAPGSMDHADTPELARRGLARHEVPGFRLARLATDIRVQGNGLGGQL
LGAIGRRCIRVAAEVGGVMLIIDAKNERAAAWYASYGAITLHDKPLTLILPFATLERELRSAGQL
MRRYARQSHELGGAKTFLAVDDTDNKTILGFYSIAPGSMDHADTPELARRGLARHEVPGFRLARLATDIRVQGNGLGGQL
LGAIGRRCIRVAAEVGGVMLIIDAKNERAAAWYASYGAITLHDKPLTLILPFATLERELRSAGQL
Download Length: 438 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|