Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 2251374..2251951 | Replicon | chromosome |
| Accession | NZ_CP117471 | ||
| Organism | Sphingobium sp. YC-XJ3 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | D4Z5D7 |
| Locus tag | PO876_RS10990 | Protein ID | WP_013041111.1 |
| Coordinates | 2251374..2251709 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | D4Z5D8 |
| Locus tag | PO876_RS10995 | Protein ID | WP_013041112.1 |
| Coordinates | 2251709..2251951 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PO876_RS10960 (PO876_10960) | 2247339..2247485 | - | 147 | WP_167532622.1 | hypothetical protein | - |
| PO876_RS10965 (PO876_10965) | 2247758..2248446 | - | 689 | Protein_2154 | pentapeptide repeat-containing protein | - |
| PO876_RS10970 (PO876_10970) | 2248540..2249190 | - | 651 | WP_013041105.1 | lytic transglycosylase domain-containing protein | - |
| PO876_RS10975 (PO876_10975) | 2249178..2249750 | - | 573 | WP_013041106.1 | signal peptidase I | - |
| PO876_RS10980 (PO876_10980) | 2249747..2250004 | - | 258 | WP_013041107.1 | helix-turn-helix domain-containing protein | - |
| PO876_RS10985 (PO876_10985) | 2250180..2250500 | - | 321 | WP_013041108.1 | DUF736 domain-containing protein | - |
| PO876_RS10990 (PO876_10990) | 2251374..2251709 | - | 336 | WP_013041111.1 | endoribonuclease MazF | Toxin |
| PO876_RS10995 (PO876_10995) | 2251709..2251951 | - | 243 | WP_013041112.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| PO876_RS11000 (PO876_11000) | 2252076..2252285 | - | 210 | WP_013041113.1 | hypothetical protein | - |
| PO876_RS11005 (PO876_11005) | 2252466..2253506 | - | 1041 | WP_274053773.1 | chromosome partitioning protein ParB | - |
| PO876_RS11010 (PO876_11010) | 2253561..2253791 | + | 231 | WP_274053775.1 | hypothetical protein | - |
| PO876_RS11015 (PO876_11015) | 2253800..2254804 | - | 1005 | WP_274053778.1 | tyrosine-type recombinase/integrase | - |
| PO876_RS11020 (PO876_11020) | 2254801..2255712 | - | 912 | WP_274053780.1 | tyrosine-type recombinase/integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 2213016..2305469 | 92453 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12025.02 Da Isoelectric Point: 9.5826
>T271223 WP_013041111.1 NZ_CP117471:c2251709-2251374 [Sphingobium sp. YC-XJ3]
MASRYIPDTGDIVWLQFDPQAGHEQAGHRPALVLSPAAYNKLRGMMICCPMTSQIKGYPFEVTVSQAPPSIVLSDQIKSL
DWKARGAKKKGSVSTAVIDEVRAKIGTLLGL
MASRYIPDTGDIVWLQFDPQAGHEQAGHRPALVLSPAAYNKLRGMMICCPMTSQIKGYPFEVTVSQAPPSIVLSDQIKSL
DWKARGAKKKGSVSTAVIDEVRAKIGTLLGL
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | D4Z5D7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A848HW50 |