Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 2251374..2251951 Replicon chromosome
Accession NZ_CP117471
Organism Sphingobium sp. YC-XJ3

Toxin (Protein)


Gene name mazF Uniprot ID D4Z5D7
Locus tag PO876_RS10990 Protein ID WP_013041111.1
Coordinates 2251374..2251709 (-) Length 112 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID D4Z5D8
Locus tag PO876_RS10995 Protein ID WP_013041112.1
Coordinates 2251709..2251951 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PO876_RS10960 (PO876_10960) 2247339..2247485 - 147 WP_167532622.1 hypothetical protein -
PO876_RS10965 (PO876_10965) 2247758..2248446 - 689 Protein_2154 pentapeptide repeat-containing protein -
PO876_RS10970 (PO876_10970) 2248540..2249190 - 651 WP_013041105.1 lytic transglycosylase domain-containing protein -
PO876_RS10975 (PO876_10975) 2249178..2249750 - 573 WP_013041106.1 signal peptidase I -
PO876_RS10980 (PO876_10980) 2249747..2250004 - 258 WP_013041107.1 helix-turn-helix domain-containing protein -
PO876_RS10985 (PO876_10985) 2250180..2250500 - 321 WP_013041108.1 DUF736 domain-containing protein -
PO876_RS10990 (PO876_10990) 2251374..2251709 - 336 WP_013041111.1 endoribonuclease MazF Toxin
PO876_RS10995 (PO876_10995) 2251709..2251951 - 243 WP_013041112.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
PO876_RS11000 (PO876_11000) 2252076..2252285 - 210 WP_013041113.1 hypothetical protein -
PO876_RS11005 (PO876_11005) 2252466..2253506 - 1041 WP_274053773.1 chromosome partitioning protein ParB -
PO876_RS11010 (PO876_11010) 2253561..2253791 + 231 WP_274053775.1 hypothetical protein -
PO876_RS11015 (PO876_11015) 2253800..2254804 - 1005 WP_274053778.1 tyrosine-type recombinase/integrase -
PO876_RS11020 (PO876_11020) 2254801..2255712 - 912 WP_274053780.1 tyrosine-type recombinase/integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 2213016..2305469 92453


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(4-111)

Antitoxin

SpoVT-AbrB domain

(6-48)


Sequences

Toxin        


Download         Length: 112 a.a.        Molecular weight: 12025.02 Da        Isoelectric Point: 9.5826

>T271223 WP_013041111.1 NZ_CP117471:c2251709-2251374 [Sphingobium sp. YC-XJ3]
MASRYIPDTGDIVWLQFDPQAGHEQAGHRPALVLSPAAYNKLRGMMICCPMTSQIKGYPFEVTVSQAPPSIVLSDQIKSL
DWKARGAKKKGSVSTAVIDEVRAKIGTLLGL

Download         Length: 336 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8624.08 Da        Isoelectric Point: 4.6653

>AT271223 WP_013041112.1 NZ_CP117471:c2251951-2251709 [Sphingobium sp. YC-XJ3]
MGIQVKKWGNSAAIRIPSAIMAAAALNVGQEVEVRQEGGRLIIEPVLKPVYTLDALLADMKPETFHEIVDFGPPVGNEVL

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB D4Z5D7

Antitoxin

Source ID Structure
AlphaFold DB A0A848HW50

References