Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 2214762..2215327 | Replicon | chromosome |
| Accession | NZ_CP117471 | ||
| Organism | Sphingobium sp. YC-XJ3 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | D4Z593 |
| Locus tag | PO876_RS10785 | Protein ID | WP_013041067.1 |
| Coordinates | 2214956..2215327 (+) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PO876_RS10780 | Protein ID | WP_013041066.1 |
| Coordinates | 2214762..2214959 (+) | Length | 66 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PO876_RS10750 (PO876_10750) | 2210088..2210981 | - | 894 | WP_044660217.1 | N-formylglutamate amidohydrolase | - |
| PO876_RS10755 (PO876_10755) | 2211131..2211508 | + | 378 | WP_025551641.1 | response regulator | - |
| PO876_RS10760 (PO876_10760) | 2211505..2212839 | - | 1335 | WP_044660218.1 | dicarboxylate/amino acid:cation symporter | - |
| PO876_RS10770 (PO876_10770) | 2213331..2213573 | - | 243 | WP_065846227.1 | hypothetical protein | - |
| PO876_RS10775 (PO876_10775) | 2213575..2214612 | + | 1038 | WP_013041065.1 | site-specific integrase | - |
| PO876_RS10780 (PO876_10780) | 2214762..2214959 | + | 198 | WP_013041066.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PO876_RS10785 (PO876_10785) | 2214956..2215327 | + | 372 | WP_013041067.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PO876_RS10790 (PO876_10790) | 2215732..2217240 | - | 1509 | WP_274053730.1 | HipA domain-containing protein | - |
| PO876_RS10795 (PO876_10795) | 2217430..2217702 | + | 273 | WP_249902386.1 | hypothetical protein | - |
| PO876_RS10800 (PO876_10800) | 2217713..2217865 | - | 153 | WP_139111437.1 | IS110 family transposase | - |
| PO876_RS10805 (PO876_10805) | 2218198..2218440 | + | 243 | WP_013041071.1 | tyrosine-type recombinase/integrase | - |
| PO876_RS10810 (PO876_10810) | 2218639..2219076 | - | 438 | WP_274053734.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
| PO876_RS10815 (PO876_10815) | 2219207..2219842 | + | 636 | WP_274053736.1 | tyrosine-type recombinase/integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 2213016..2305469 | 92453 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13809.98 Da Isoelectric Point: 6.4909
>T271222 WP_013041067.1 NZ_CP117471:2214956-2215327 [Sphingobium sp. YC-XJ3]
MILVDTSVWIDHLRHDDPVLSQSLSKRQVLSHPFIIGELALGSLRQRDLILEALRGLPSVIVAHDEEVHAFIDLHRLFGI
GIGYIDAHLLAATLLTPDVQFWTRDKRLRAAALRLGVDANLDH
MILVDTSVWIDHLRHDDPVLSQSLSKRQVLSHPFIIGELALGSLRQRDLILEALRGLPSVIVAHDEEVHAFIDLHRLFGI
GIGYIDAHLLAATLLTPDVQFWTRDKRLRAAALRLGVDANLDH
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|