Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 2214762..2215327 Replicon chromosome
Accession NZ_CP117471
Organism Sphingobium sp. YC-XJ3

Toxin (Protein)


Gene name vapC Uniprot ID D4Z593
Locus tag PO876_RS10785 Protein ID WP_013041067.1
Coordinates 2214956..2215327 (+) Length 124 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag PO876_RS10780 Protein ID WP_013041066.1
Coordinates 2214762..2214959 (+) Length 66 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PO876_RS10750 (PO876_10750) 2210088..2210981 - 894 WP_044660217.1 N-formylglutamate amidohydrolase -
PO876_RS10755 (PO876_10755) 2211131..2211508 + 378 WP_025551641.1 response regulator -
PO876_RS10760 (PO876_10760) 2211505..2212839 - 1335 WP_044660218.1 dicarboxylate/amino acid:cation symporter -
PO876_RS10770 (PO876_10770) 2213331..2213573 - 243 WP_065846227.1 hypothetical protein -
PO876_RS10775 (PO876_10775) 2213575..2214612 + 1038 WP_013041065.1 site-specific integrase -
PO876_RS10780 (PO876_10780) 2214762..2214959 + 198 WP_013041066.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PO876_RS10785 (PO876_10785) 2214956..2215327 + 372 WP_013041067.1 type II toxin-antitoxin system VapC family toxin Toxin
PO876_RS10790 (PO876_10790) 2215732..2217240 - 1509 WP_274053730.1 HipA domain-containing protein -
PO876_RS10795 (PO876_10795) 2217430..2217702 + 273 WP_249902386.1 hypothetical protein -
PO876_RS10800 (PO876_10800) 2217713..2217865 - 153 WP_139111437.1 IS110 family transposase -
PO876_RS10805 (PO876_10805) 2218198..2218440 + 243 WP_013041071.1 tyrosine-type recombinase/integrase -
PO876_RS10810 (PO876_10810) 2218639..2219076 - 438 WP_274053734.1 type II toxin-antitoxin system death-on-curing family toxin -
PO876_RS10815 (PO876_10815) 2219207..2219842 + 636 WP_274053736.1 tyrosine-type recombinase/integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 2213016..2305469 92453


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-43)


Sequences

Toxin        


Download         Length: 124 a.a.        Molecular weight: 13809.98 Da        Isoelectric Point: 6.4909

>T271222 WP_013041067.1 NZ_CP117471:2214956-2215327 [Sphingobium sp. YC-XJ3]
MILVDTSVWIDHLRHDDPVLSQSLSKRQVLSHPFIIGELALGSLRQRDLILEALRGLPSVIVAHDEEVHAFIDLHRLFGI
GIGYIDAHLLAATLLTPDVQFWTRDKRLRAAALRLGVDANLDH

Download         Length: 372 bp

Antitoxin


Download         Length: 66 a.a.        Molecular weight: 7069.07 Da        Isoelectric Point: 8.9168

>AT271222 WP_013041066.1 NZ_CP117471:2214762-2214959 [Sphingobium sp. YC-XJ3]
MRTTVALDDELVAKAQAFTGLTEKSSLVREALKALIERESSARLVRLGGTEPHGEAAPRRRPDPV

Download         Length: 198 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB D4Z593

Antitoxin

Source ID Structure

References