Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacT-ataR/DUF1778(antitoxin) |
Location | 2006113..2006952 | Replicon | chromosome |
Accession | NZ_CP117471 | ||
Organism | Sphingobium sp. YC-XJ3 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A0S3EYY3 |
Locus tag | PO876_RS09710 | Protein ID | WP_062064438.1 |
Coordinates | 2006437..2006952 (+) | Length | 172 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | A0A0S3EYZ1 |
Locus tag | PO876_RS09705 | Protein ID | WP_062064445.1 |
Coordinates | 2006113..2006421 (+) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PO876_RS09675 (PO876_09675) | 2001240..2001572 | - | 333 | WP_062064454.1 | TrbC/VirB2 family protein | - |
PO876_RS09680 (PO876_09680) | 2001569..2002555 | - | 987 | WP_062064452.1 | P-type conjugative transfer ATPase TrbB | - |
PO876_RS09685 (PO876_09685) | 2002808..2003173 | + | 366 | WP_062064450.1 | hypothetical protein | - |
PO876_RS09690 (PO876_09690) | 2003243..2003500 | - | 258 | WP_257541981.1 | type II toxin-antitoxin system ParD family antitoxin | - |
PO876_RS09695 (PO876_09695) | 2003614..2004036 | - | 423 | WP_062064448.1 | CopG family transcriptional regulator | - |
PO876_RS09700 (PO876_09700) | 2004045..2006030 | - | 1986 | WP_062064447.1 | conjugal transfer protein TraG | - |
PO876_RS09705 (PO876_09705) | 2006113..2006421 | + | 309 | WP_062064445.1 | DUF1778 domain-containing protein | Antitoxin |
PO876_RS09710 (PO876_09710) | 2006437..2006952 | + | 516 | WP_062064438.1 | GNAT family N-acetyltransferase | Toxin |
PO876_RS09715 (PO876_09715) | 2006967..2008742 | - | 1776 | WP_062064436.1 | DUF3363 domain-containing protein | - |
PO876_RS09720 (PO876_09720) | 2008981..2009562 | - | 582 | WP_062064435.1 | hypothetical protein | - |
PO876_RS09725 (PO876_09725) | 2009559..2010266 | - | 708 | WP_062064433.1 | lytic transglycosylase domain-containing protein | - |
PO876_RS09730 (PO876_09730) | 2010271..2010615 | - | 345 | WP_062064431.1 | DUF736 domain-containing protein | - |
PO876_RS09735 (PO876_09735) | 2010651..2010998 | - | 348 | WP_062064429.1 | DUF736 domain-containing protein | - |
PO876_RS09740 (PO876_09740) | 2010979..2011557 | - | 579 | WP_062064427.1 | S26 family signal peptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 172 a.a. Molecular weight: 18179.96 Da Isoelectric Point: 8.5126
>T271221 WP_062064438.1 NZ_CP117471:2006437-2006952 [Sphingobium sp. YC-XJ3]
VADIRITPPARLTADHDVAGFANGVHASLDDWLRDRALASEGSSARTYVVCNAAEPRRVVGYYTITTAMEQRAALPSAKL
RRGMPDRVPLLLIGRLAVDAGFQGIGLGADLLADALRRCAAAAEIAGARAVIVHAIDEKAAAFYARHGFIPTSLGELVML
LPIEAIRSRPN
VADIRITPPARLTADHDVAGFANGVHASLDDWLRDRALASEGSSARTYVVCNAAEPRRVVGYYTITTAMEQRAALPSAKL
RRGMPDRVPLLLIGRLAVDAGFQGIGLGADLLADALRRCAAAAEIAGARAVIVHAIDEKAAAFYARHGFIPTSLGELVML
LPIEAIRSRPN
Download Length: 516 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S3EYY3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S3EYZ1 |