Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 1652049..1652506 Replicon chromosome
Accession NZ_CP117471
Organism Sphingobium sp. YC-XJ3

Toxin (Protein)


Gene name relE Uniprot ID A0A4Q4J3V7
Locus tag PO876_RS07915 Protein ID WP_044662619.1
Coordinates 1652231..1652506 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A292ZD49
Locus tag PO876_RS07910 Protein ID WP_044662618.1
Coordinates 1652049..1652231 (+) Length 61 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PO876_RS07890 (PO876_07890) 1647168..1650080 + 2913 WP_044662615.1 excinuclease ABC subunit UvrA -
PO876_RS07895 (PO876_07895) 1650156..1651232 + 1077 WP_044662616.1 type I restriction enzyme HsdR N-terminal domain-containing protein -
PO876_RS07900 (PO876_07900) 1651240..1651800 + 561 WP_083199195.1 hypothetical protein -
PO876_RS07905 (PO876_07905) 1651748..1651972 + 225 WP_238320079.1 hypothetical protein -
PO876_RS07910 (PO876_07910) 1652049..1652231 + 183 WP_044662618.1 hypothetical protein Antitoxin
PO876_RS07915 (PO876_07915) 1652231..1652506 + 276 WP_044662619.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
PO876_RS07920 (PO876_07920) 1652590..1653591 + 1002 WP_130029751.1 hypothetical protein -
PO876_RS07925 (PO876_07925) 1653762..1653974 + 213 WP_007684722.1 cold-shock protein -
PO876_RS07930 (PO876_07930) 1654037..1654213 + 177 WP_165363300.1 hypothetical protein -
PO876_RS07935 (PO876_07935) 1654342..1654560 + 219 WP_025550213.1 hypothetical protein -
PO876_RS07940 (PO876_07940) 1654731..1655075 + 345 WP_025550214.1 glycine zipper 2TM domain-containing protein -
PO876_RS07945 (PO876_07945) 1655133..1656065 - 933 WP_044662621.1 FAD-binding protein -
PO876_RS07950 (PO876_07950) 1656062..1656811 - 750 WP_044663190.1 electron transfer flavoprotein subunit beta/FixA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-90)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10438.92 Da        Isoelectric Point: 6.4801

>T271220 WP_044662619.1 NZ_CP117471:1652231-1652506 [Sphingobium sp. YC-XJ3]
MPHVIWRPKALEDADRIIDYISDRNPAAAARLADLFEYAAERLADHPYMHRAGRVPDTREAIVTPNYILVYRAGADVIEI
LAILHTRQQYP

Download         Length: 276 bp

Antitoxin


Download         Length: 61 a.a.        Molecular weight: 6641.62 Da        Isoelectric Point: 5.7833

>AT271220 WP_044662618.1 NZ_CP117471:1652049-1652231 [Sphingobium sp. YC-XJ3]
MTKLTPIESEFATTEDAEAYDAWFRAKVEAALADPRPGIPHDQVMAKLRAIIEAKKAKQA

Download         Length: 183 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4Q4J3V7

Antitoxin

Source ID Structure
AlphaFold DB A0A292ZD49

References