Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-CC2985 |
| Location | 445133..445661 | Replicon | chromosome |
| Accession | NZ_CP117471 | ||
| Organism | Sphingobium sp. YC-XJ3 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | PO876_RS02050 | Protein ID | WP_274051983.1 |
| Coordinates | 445371..445661 (+) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | PO876_RS02045 | Protein ID | WP_274051980.1 |
| Coordinates | 445133..445378 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PO876_RS02030 (PO876_02030) | 440180..441535 | - | 1356 | WP_009823940.1 | tyrosine-type recombinase/integrase | - |
| PO876_RS02035 (PO876_02035) | 441532..442764 | - | 1233 | WP_007015824.1 | site-specific integrase | - |
| PO876_RS02040 (PO876_02040) | 442922..445018 | + | 2097 | WP_274051978.1 | strawberry notch C-terminal domain-containing protein | - |
| PO876_RS02045 (PO876_02045) | 445133..445378 | + | 246 | WP_274051980.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| PO876_RS02050 (PO876_02050) | 445371..445661 | + | 291 | WP_274051983.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PO876_RS02055 (PO876_02055) | 445844..447523 | + | 1680 | WP_274051985.1 | ATP-binding protein | - |
| PO876_RS02060 (PO876_02060) | 447630..448820 | + | 1191 | WP_274051987.1 | DUF932 domain-containing protein | - |
| PO876_RS02065 (PO876_02065) | 448875..449456 | + | 582 | WP_274051988.1 | hypothetical protein | - |
| PO876_RS02070 (PO876_02070) | 449518..449820 | + | 303 | WP_274051989.1 | hypothetical protein | - |
| PO876_RS02075 (PO876_02075) | 449842..450537 | + | 696 | WP_274051991.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 368513..485731 | 117218 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11175.81 Da Isoelectric Point: 9.0764
>T271219 WP_274051983.1 NZ_CP117471:445371-445661 [Sphingobium sp. YC-XJ3]
MAEFRLSPRAQRDIDGIFDYTVKHWGLPQALRYMDLIEAACTSLADAPQQAQDCSVIRPGYRRRSVELHSIYFRQTSYGI
AVIRILHQRMDPSRHI
MAEFRLSPRAQRDIDGIFDYTVKHWGLPQALRYMDLIEAACTSLADAPQQAQDCSVIRPGYRRRSVELHSIYFRQTSYGI
AVIRILHQRMDPSRHI
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|