Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /SpoIISA(toxin) |
| Location | 2255232..2256210 | Replicon | chromosome |
| Accession | NZ_CP117421 | ||
| Organism | Bacillus cereus strain 2-6A | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | W8Y388 |
| Locus tag | PRK74_RS11665 | Protein ID | WP_000624977.1 |
| Coordinates | 2255232..2255969 (+) | Length | 246 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | W8YZL5 |
| Locus tag | PRK74_RS11670 | Protein ID | WP_000237818.1 |
| Coordinates | 2256082..2256210 (+) | Length | 43 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PRK74_RS11645 (PRK74_11645) | 2250875..2251657 | + | 783 | WP_273634872.1 | class I SAM-dependent methyltransferase | - |
| PRK74_RS11650 (PRK74_11650) | 2251815..2253500 | - | 1686 | WP_119780893.1 | alpha-keto acid decarboxylase family protein | - |
| PRK74_RS11655 (PRK74_11655) | 2253608..2254090 | + | 483 | WP_000191888.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| PRK74_RS11660 (PRK74_11660) | 2254257..2254994 | + | 738 | WP_000594150.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
| PRK74_RS11665 (PRK74_11665) | 2255232..2255969 | + | 738 | WP_000624977.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
| PRK74_RS11670 (PRK74_11670) | 2256082..2256210 | + | 129 | WP_000237818.1 | hypothetical protein | Antitoxin |
| PRK74_RS11675 (PRK74_11675) | 2256283..2256459 | + | 177 | WP_000852629.1 | stage II sporulation protein SB | - |
| PRK74_RS11680 (PRK74_11680) | 2256478..2256867 | - | 390 | WP_000713866.1 | YxeA family protein | - |
| PRK74_RS11685 (PRK74_11685) | 2257079..2258548 | + | 1470 | WP_128266961.1 | beta-Ala-His dipeptidase | - |
| PRK74_RS11690 (PRK74_11690) | 2258794..2259603 | + | 810 | WP_119780889.1 | papain-like cysteine protease family protein | - |
| PRK74_RS11695 (PRK74_11695) | 2259629..2260231 | + | 603 | WP_000517260.1 | hypothetical protein | - |
| PRK74_RS11700 (PRK74_11700) | 2260472..2260723 | - | 252 | WP_030025648.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 246 a.a. Molecular weight: 28307.03 Da Isoelectric Point: 8.2998
>T271216 WP_000624977.1 NZ_CP117421:2255232-2255969 [Bacillus cereus]
MISNIRIGLFVLAIVFVVLVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSIIVPLEHIEQLNEQKAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
MISNIRIGLFVLAIVFVVLVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSIIVPLEHIEQLNEQKAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
Download Length: 738 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|