Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 240981..241623 | Replicon | chromosome |
Accession | NZ_CP117421 | ||
Organism | Bacillus cereus strain 2-6A |
Toxin (Protein)
Gene name | pemK | Uniprot ID | R8I8B8 |
Locus tag | PRK74_RS01365 | Protein ID | WP_000635965.1 |
Coordinates | 241273..241623 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | R8I8H2 |
Locus tag | PRK74_RS01360 | Protein ID | WP_000004570.1 |
Coordinates | 240981..241268 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PRK74_RS01335 (PRK74_01335) | 236298..237260 | + | 963 | WP_000961161.1 | UV DNA damage repair endonuclease UvsE | - |
PRK74_RS01340 (PRK74_01340) | 237253..237825 | - | 573 | WP_000908523.1 | rhomboid family intramembrane serine protease | - |
PRK74_RS01345 (PRK74_01345) | 237919..238278 | + | 360 | WP_000583417.1 | holo-ACP synthase | - |
PRK74_RS01350 (PRK74_01350) | 238435..239385 | + | 951 | WP_002004297.1 | outer membrane lipoprotein carrier protein LolA | - |
PRK74_RS01355 (PRK74_01355) | 239503..240672 | + | 1170 | WP_000390617.1 | alanine racemase | - |
PRK74_RS01360 (PRK74_01360) | 240981..241268 | + | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
PRK74_RS01365 (PRK74_01365) | 241273..241623 | + | 351 | WP_000635965.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
PRK74_RS01370 (PRK74_01370) | 241691..243859 | + | 2169 | WP_000426241.1 | Tex family protein | - |
PRK74_RS01375 (PRK74_01375) | 243917..244033 | - | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
PRK74_RS01380 (PRK74_01380) | 244228..244686 | + | 459 | WP_000344241.1 | SprT family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12948.04 Da Isoelectric Point: 5.7168
>T271215 WP_000635965.1 NZ_CP117421:241273-241623 [Bacillus cereus]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMSRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMSRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366G118 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366FY90 |