Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/CC2985(antitoxin) |
| Location | 780989..781539 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP117418 | ||
| Organism | Novosphingobium humi strain KACC 19094 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | G6EGT7 |
| Locus tag | PQ457_RS19400 | Protein ID | WP_007014466.1 |
| Coordinates | 781237..781539 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | F6ICG1 |
| Locus tag | PQ457_RS19395 | Protein ID | WP_013831443.1 |
| Coordinates | 780989..781234 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQ457_RS19375 (PQ457_19375) | 776561..777526 | + | 966 | WP_273619450.1 | GlxA family transcriptional regulator | - |
| PQ457_RS19380 (PQ457_19380) | 777901..779094 | - | 1194 | WP_273619451.1 | IS91 family transposase | - |
| PQ457_RS19385 (PQ457_19385) | 779099..780007 | - | 909 | WP_273619452.1 | tyrosine-type recombinase/integrase | - |
| PQ457_RS19390 (PQ457_19390) | 780184..780816 | - | 633 | WP_273619453.1 | tyrosine-type recombinase/integrase | - |
| PQ457_RS19395 (PQ457_19395) | 780989..781234 | + | 246 | WP_013831443.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| PQ457_RS19400 (PQ457_19400) | 781237..781539 | + | 303 | WP_007014466.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PQ457_RS19405 (PQ457_19405) | 781900..782268 | - | 369 | WP_273619455.1 | YegP family protein | - |
| PQ457_RS19410 (PQ457_19410) | 782588..782773 | + | 186 | WP_273619456.1 | hypothetical protein | - |
| PQ457_RS19415 (PQ457_19415) | 782770..782991 | + | 222 | WP_273619457.1 | hypothetical protein | - |
| PQ457_RS19420 (PQ457_19420) | 783053..783742 | - | 690 | WP_273620406.1 | spermidine synthase | - |
| PQ457_RS19425 (PQ457_19425) | 783742..784236 | - | 495 | WP_273619458.1 | YaiI/YqxD family protein | - |
| PQ457_RS19430 (PQ457_19430) | 784567..784773 | + | 207 | WP_273619459.1 | cold-shock protein | - |
| PQ457_RS19435 (PQ457_19435) | 785000..786070 | - | 1071 | WP_273619460.1 | MBL fold metallo-hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..1319841 | 1319841 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11270.64 Da Isoelectric Point: 5.4710
>T271214 WP_007014466.1 NZ_CP117418:781237-781539 [Novosphingobium humi]
VPRFHLTRAAADDLTAIFLEGIEQFGLPQADAYHEGLSAIFAFLADYPHAARLREEISPPVRVHPYKAHLVIYDVGNEGE
VIILRVRHGREDWTSSNYDG
VPRFHLTRAAADDLTAIFLEGIEQFGLPQADAYHEGLSAIFAFLADYPHAARLREEISPPVRVHPYKAHLVIYDVGNEGE
VIILRVRHGREDWTSSNYDG
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G6EGT7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A158S7A8 |