Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 1367999..1368634 | Replicon | chromosome |
| Accession | NZ_CP117416 | ||
| Organism | Paenibacillus kyungheensis strain KACC 18744 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | A0A1E3L8D9 |
| Locus tag | PQ456_RS05885 | Protein ID | WP_069326106.1 |
| Coordinates | 1368284..1368634 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | PQ456_RS05880 | Protein ID | WP_069326107.1 |
| Coordinates | 1367999..1368280 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQ456_RS05860 (PQ456_05860) | 1363606..1364862 | + | 1257 | WP_273615298.1 | SPFH domain-containing protein | - |
| PQ456_RS05865 (PQ456_05865) | 1364864..1365619 | + | 756 | WP_273615299.1 | hypothetical protein | - |
| PQ456_RS05870 (PQ456_05870) | 1365687..1366340 | + | 654 | WP_273615300.1 | hypothetical protein | - |
| PQ456_RS05875 (PQ456_05875) | 1366583..1367776 | + | 1194 | WP_273616255.1 | alanine racemase | - |
| PQ456_RS05880 (PQ456_05880) | 1367999..1368280 | + | 282 | WP_069326107.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| PQ456_RS05885 (PQ456_05885) | 1368284..1368634 | + | 351 | WP_069326106.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PQ456_RS05890 (PQ456_05890) | 1368828..1371053 | + | 2226 | WP_273615301.1 | Tex family protein | - |
| PQ456_RS05895 (PQ456_05895) | 1371299..1371664 | - | 366 | WP_273615302.1 | hydrolase/acyltransferase | - |
| PQ456_RS05900 (PQ456_05900) | 1371796..1372281 | + | 486 | WP_273593461.1 | SprT family protein | - |
| PQ456_RS05915 (PQ456_05915) | 1372682..1373557 | - | 876 | WP_273615303.1 | Cof-type HAD-IIB family hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12927.91 Da Isoelectric Point: 6.4842
>T271213 WP_069326106.1 NZ_CP117416:1368284-1368634 [Paenibacillus kyungheensis]
MIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKSHGFDRDSVILLEQI
RTIDKQRLTDKITHLDEETMRRVHDALQISLGLVEF
MIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKSHGFDRDSVILLEQI
RTIDKQRLTDKITHLDEETMRRVHDALQISLGLVEF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|