Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PemK-MazE |
| Location | 2466527..2467062 | Replicon | chromosome |
| Accession | NZ_CP117411 | ||
| Organism | Sphingomonas naphthae strain KACC 18716 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | PQ455_RS11875 | Protein ID | WP_273686294.1 |
| Coordinates | 2466742..2467062 (+) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | PQ455_RS11870 | Protein ID | WP_273686293.1 |
| Coordinates | 2466527..2466745 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQ455_RS11850 (PQ455_11850) | 2464037..2464321 | - | 285 | WP_273686288.1 | GNAT family N-acetyltransferase | - |
| PQ455_RS11855 (PQ455_11855) | 2464465..2464590 | - | 126 | WP_004210176.1 | type B 50S ribosomal protein L36 | - |
| PQ455_RS11860 (PQ455_11860) | 2464750..2465343 | + | 594 | WP_273686291.1 | DUF4136 domain-containing protein | - |
| PQ455_RS11865 (PQ455_11865) | 2465340..2466467 | + | 1128 | WP_273686292.1 | M14-type cytosolic carboxypeptidase | - |
| PQ455_RS11870 (PQ455_11870) | 2466527..2466745 | + | 219 | WP_273686293.1 | antitoxin MazE family protein | Antitoxin |
| PQ455_RS11875 (PQ455_11875) | 2466742..2467062 | + | 321 | WP_273686294.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PQ455_RS11880 (PQ455_11880) | 2467143..2467697 | - | 555 | WP_273686295.1 | FKBP-type peptidyl-prolyl cis-trans isomerase | - |
| PQ455_RS11885 (PQ455_11885) | 2467744..2467950 | - | 207 | WP_007404630.1 | 30S ribosomal protein S21 | - |
| PQ455_RS11890 (PQ455_11890) | 2468164..2468712 | + | 549 | WP_273686296.1 | (2Fe-2S)-binding protein | - |
| PQ455_RS11895 (PQ455_11895) | 2468861..2469637 | + | 777 | WP_273686297.1 | RcnB family protein | - |
| PQ455_RS11900 (PQ455_11900) | 2469851..2470327 | + | 477 | WP_273686298.1 | RcnB family protein | - |
| PQ455_RS11905 (PQ455_11905) | 2470428..2471111 | - | 684 | WP_273686299.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 11495.46 Da Isoelectric Point: 10.4418
>T271212 WP_273686294.1 NZ_CP117411:2466742-2467062 [Sphingomonas naphthae]
VRRGDIVTIATPGDFGKPRPALIIQSDQFETGTITVLLVTSTLLDAPLLRPSIQPSPENGLRKPSQVMIDKPMSIRRDRI
GDVFGRLDAETMLAVTRALAVFLGIA
VRRGDIVTIATPGDFGKPRPALIIQSDQFETGTITVLLVTSTLLDAPLLRPSIQPSPENGLRKPSQVMIDKPMSIRRDRI
GDVFGRLDAETMLAVTRALAVFLGIA
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|