271206

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4325636..4326471 Replicon chromosome
Accession NZ_CP117404
Organism Salmonella enterica subsp. enterica serovar Typhimurium strain RM085

Toxin (Protein)


Gene name yeeV Uniprot ID A0A1V1GYU4
Locus tag PQQ07_RS21070 Protein ID WP_000854719.1
Coordinates 4326094..4326471 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag PQQ07_RS21065 Protein ID WP_001285113.1
Coordinates 4325636..4326004 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ07_RS21025 (4320753) 4320753..4321637 + 885 WP_000010398.1 50S ribosome-binding GTPase -
PQQ07_RS21030 (4321755) 4321755..4322432 + 678 WP_001097369.1 hypothetical protein -
PQQ07_RS21035 (4322438) 4322438..4322671 + 234 WP_001278282.1 DUF905 family protein -
PQQ07_RS21040 (4322761) 4322761..4323579 + 819 WP_001175145.1 DUF932 domain-containing protein -
PQQ07_RS21045 (4323656) 4323656..4324141 + 486 WP_000213705.1 antirestriction protein -
PQQ07_RS21050 (4324157) 4324157..4324633 + 477 WP_001186715.1 RadC family protein -
PQQ07_RS21055 (4324702) 4324702..4324923 + 222 WP_000692345.1 DUF987 domain-containing protein -
PQQ07_RS21060 (4324942) 4324942..4325586 + 645 WP_000086770.1 hypothetical protein -
PQQ07_RS21065 (4325636) 4325636..4326004 + 369 WP_001285113.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
PQQ07_RS21070 (4326094) 4326094..4326471 + 378 WP_000854719.1 TA system toxin CbtA family protein Toxin
PQQ07_RS21075 (4326468) 4326468..4326956 + 489 WP_000761679.1 DUF5983 family protein -
PQQ07_RS21080 (4326974) 4326974..4327171 + 198 WP_000839266.1 DUF957 domain-containing protein -
PQQ07_RS21085 (4327256) 4327256..4328101 + 846 WP_001440175.1 DUF4942 domain-containing protein -
PQQ07_RS21090 (4328170) 4328170..4328565 + 396 WP_000208386.1 DUF6088 family protein -
PQQ07_RS21095 (4328558) 4328558..4329505 + 948 WP_001440173.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
PQQ07_RS21100 (4329791) 4329791..4329868 - 78 Protein_4123 helix-turn-helix domain-containing protein -
PQQ07_RS21105 (4329959) 4329959..4330291 - 333 WP_001165471.1 MerR family transcriptional regulator -
PQQ07_RS21110 (4330363) 4330363..4330740 + 378 WP_000916345.1 EthD family reductase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island floR - 4300626..4336875 36249


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14059.10 Da        Isoelectric Point: 8.2904

>T271206 WP_000854719.1 NZ_CP117404:4326094-4326471 [Salmonella enterica subsp. enterica serovar Typhimurium]
MKTLPDTHVREASRCPSPVTIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13693.33 Da        Isoelectric Point: 5.4970

>AT271206 WP_001285113.1 NZ_CP117404:4325636-4326004 [Salmonella enterica subsp. enterica serovar Typhimurium]
VSDSLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRHQHTVTLYARGLTCEADTLGSCGYVYLAVYPTSETKT

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1V1GYU4

Antitoxin

Source ID Structure

References