Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3478059..3478679 | Replicon | chromosome |
Accession | NZ_CP117404 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain RM085 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PQQ07_RS17110 | Protein ID | WP_001280991.1 |
Coordinates | 3478461..3478679 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | PQQ07_RS17105 | Protein ID | WP_000344807.1 |
Coordinates | 3478059..3478433 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ07_RS17095 (3473198) | 3473198..3474391 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PQQ07_RS17100 (3474414) | 3474414..3477563 | + | 3150 | WP_274896137.1 | efflux RND transporter permease AcrB | - |
PQQ07_RS17105 (3478059) | 3478059..3478433 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
PQQ07_RS17110 (3478461) | 3478461..3478679 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PQQ07_RS17115 (3478858) | 3478858..3479409 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
PQQ07_RS17120 (3479526) | 3479526..3479996 | + | 471 | WP_000136181.1 | YlaC family protein | - |
PQQ07_RS17125 (3480052) | 3480052..3480192 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PQQ07_RS17130 (3480198) | 3480198..3480458 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PQQ07_RS17135 (3480683) | 3480683..3482233 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
PQQ07_RS17145 (3482464) | 3482464..3482853 | + | 390 | WP_000961285.1 | MGMT family protein | - |
PQQ07_RS17150 (3482886) | 3482886..3483455 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T271201 WP_001280991.1 NZ_CP117404:3478461-3478679 [Salmonella enterica subsp. enterica serovar Typhimurium]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT271201 WP_000344807.1 NZ_CP117404:3478059-3478433 [Salmonella enterica subsp. enterica serovar Typhimurium]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|