Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3320634..3321254 | Replicon | chromosome |
| Accession | NZ_CP117402 | ||
| Organism | Salmonella enterica subsp. enterica serovar Give strain RM007 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | PQQ13_RS16345 | Protein ID | WP_001280991.1 |
| Coordinates | 3321036..3321254 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | PQQ13_RS16340 | Protein ID | WP_000344807.1 |
| Coordinates | 3320634..3321008 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ13_RS16330 (3315773) | 3315773..3316966 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PQQ13_RS16335 (3316989) | 3316989..3320138 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| PQQ13_RS16340 (3320634) | 3320634..3321008 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| PQQ13_RS16345 (3321036) | 3321036..3321254 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| PQQ13_RS16350 (3321433) | 3321433..3321984 | + | 552 | WP_001278791.1 | maltose O-acetyltransferase | - |
| PQQ13_RS16355 (3322102) | 3322102..3322572 | + | 471 | WP_000136183.1 | YlaC family protein | - |
| PQQ13_RS16360 (3322628) | 3322628..3322768 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| PQQ13_RS16365 (3322774) | 3322774..3323034 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| PQQ13_RS16370 (3323259) | 3323259..3324809 | + | 1551 | WP_023230872.1 | EAL domain-containing protein | - |
| PQQ13_RS16380 (3325040) | 3325040..3325429 | + | 390 | WP_023230873.1 | MGMT family protein | - |
| PQQ13_RS16385 (3325462) | 3325462..3326031 | - | 570 | WP_000779801.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T271184 WP_001280991.1 NZ_CP117402:3321036-3321254 [Salmonella enterica subsp. enterica serovar Give]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT271184 WP_000344807.1 NZ_CP117402:3320634-3321008 [Salmonella enterica subsp. enterica serovar Give]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|