Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) stbDE/ParE-YafN
Location 2319174..2319696 Replicon chromosome
Accession NZ_CP117402
Organism Salmonella enterica subsp. enterica serovar Give strain RM007

Toxin (Protein)


Gene name stbE Uniprot ID A0A5J1ICX1
Locus tag PQQ13_RS11265 Protein ID WP_000221344.1
Coordinates 2319412..2319696 (+) Length 95 a.a.

Antitoxin (Protein)


Gene name stbD Uniprot ID V1H457
Locus tag PQQ13_RS11260 Protein ID WP_000885424.1
Coordinates 2319174..2319422 (+) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ13_RS11230 (2314342) 2314342..2314557 + 216 WP_001530185.1 hypothetical protein -
PQQ13_RS11235 (2314992) 2314992..2315915 + 924 WP_023230780.1 hypothetical protein -
PQQ13_RS11240 (2316330) 2316330..2316905 + 576 Protein_2196 helix-turn-helix domain-containing protein -
PQQ13_RS11245 (2316976) 2316976..2317926 - 951 WP_000941990.1 toll/interleukin-1 receptor domain-containing protein -
PQQ13_RS11250 (2318090) 2318090..2318422 - 333 WP_000253166.1 DUF1493 family protein -
PQQ13_RS11255 (2318416) 2318416..2318874 - 459 WP_000381836.1 hypothetical protein -
PQQ13_RS11260 (2319174) 2319174..2319422 + 249 WP_000885424.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PQQ13_RS11265 (2319412) 2319412..2319696 + 285 WP_000221344.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PQQ13_RS11270 (2319815) 2319815..2320096 + 282 Protein_2202 RidA family protein -
PQQ13_RS11275 (2320148) 2320148..2321227 - 1080 WP_000954705.1 S-adenosylmethionine:tRNA ribosyltransferase-isomerase -
PQQ13_RS11280 (2321420) 2321420..2321908 - 489 WP_001293633.1 MarR family winged helix-turn-helix transcriptional regulator -
PQQ13_RS11285 (2321953) 2321953..2323461 + 1509 WP_000199421.1 FAD-dependent oxidoreductase -
PQQ13_RS11290 (2323451) 2323451..2324692 + 1242 WP_001095723.1 MFS transporter -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2313430..2326318 12888


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-84)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 11015.73 Da        Isoelectric Point: 10.5388

>T271183 WP_000221344.1 NZ_CP117402:2319412-2319696 [Salmonella enterica subsp. enterica serovar Give]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTQHRS

Download         Length: 285 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 9090.32 Da        Isoelectric Point: 3.9820

>AT271183 WP_000885424.1 NZ_CP117402:2319174-2319422 [Salmonella enterica subsp. enterica serovar Give]
MAFQILTTTAASITELKRDPMGTFNAGDGAPVAILNRNEPAFYCVPPALYAHLMDILEDEELGRIIDERANERVIEVNID
DL

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5J1ICX1

Antitoxin

Source ID Structure
AlphaFold DB A0A5I0WPN5

References