Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2319174..2319696 | Replicon | chromosome |
Accession | NZ_CP117402 | ||
Organism | Salmonella enterica subsp. enterica serovar Give strain RM007 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | A0A5J1ICX1 |
Locus tag | PQQ13_RS11265 | Protein ID | WP_000221344.1 |
Coordinates | 2319412..2319696 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | PQQ13_RS11260 | Protein ID | WP_000885424.1 |
Coordinates | 2319174..2319422 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ13_RS11230 (2314342) | 2314342..2314557 | + | 216 | WP_001530185.1 | hypothetical protein | - |
PQQ13_RS11235 (2314992) | 2314992..2315915 | + | 924 | WP_023230780.1 | hypothetical protein | - |
PQQ13_RS11240 (2316330) | 2316330..2316905 | + | 576 | Protein_2196 | helix-turn-helix domain-containing protein | - |
PQQ13_RS11245 (2316976) | 2316976..2317926 | - | 951 | WP_000941990.1 | toll/interleukin-1 receptor domain-containing protein | - |
PQQ13_RS11250 (2318090) | 2318090..2318422 | - | 333 | WP_000253166.1 | DUF1493 family protein | - |
PQQ13_RS11255 (2318416) | 2318416..2318874 | - | 459 | WP_000381836.1 | hypothetical protein | - |
PQQ13_RS11260 (2319174) | 2319174..2319422 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PQQ13_RS11265 (2319412) | 2319412..2319696 | + | 285 | WP_000221344.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PQQ13_RS11270 (2319815) | 2319815..2320096 | + | 282 | Protein_2202 | RidA family protein | - |
PQQ13_RS11275 (2320148) | 2320148..2321227 | - | 1080 | WP_000954705.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
PQQ13_RS11280 (2321420) | 2321420..2321908 | - | 489 | WP_001293633.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
PQQ13_RS11285 (2321953) | 2321953..2323461 | + | 1509 | WP_000199421.1 | FAD-dependent oxidoreductase | - |
PQQ13_RS11290 (2323451) | 2323451..2324692 | + | 1242 | WP_001095723.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2313430..2326318 | 12888 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11015.73 Da Isoelectric Point: 10.5388
>T271183 WP_000221344.1 NZ_CP117402:2319412-2319696 [Salmonella enterica subsp. enterica serovar Give]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTQHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTQHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5J1ICX1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |