Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 815976..816636 | Replicon | chromosome |
Accession | NZ_CP117402 | ||
Organism | Salmonella enterica subsp. enterica serovar Give strain RM007 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A5I1G658 |
Locus tag | PQQ13_RS03955 | Protein ID | WP_001727955.1 |
Coordinates | 816223..816636 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S5MU13 |
Locus tag | PQQ13_RS03950 | Protein ID | WP_000351186.1 |
Coordinates | 815976..816242 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ13_RS03930 (811904) | 811904..813337 | - | 1434 | WP_023217487.1 | 6-phospho-beta-glucosidase BglA | - |
PQQ13_RS03935 (813496) | 813496..813807 | + | 312 | WP_023217488.1 | N(4)-acetylcytidine aminohydrolase | - |
PQQ13_RS03940 (813971) | 813971..814630 | + | 660 | WP_000250289.1 | hemolysin III family protein | - |
PQQ13_RS03945 (814746) | 814746..815726 | - | 981 | WP_000874169.1 | tRNA-modifying protein YgfZ | - |
PQQ13_RS03950 (815976) | 815976..816242 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
PQQ13_RS03955 (816223) | 816223..816636 | + | 414 | WP_001727955.1 | protein YgfX | Toxin |
PQQ13_RS03960 (816689) | 816689..817210 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
PQQ13_RS03965 (817323) | 817323..818219 | + | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
PQQ13_RS03970 (818243) | 818243..818956 | + | 714 | WP_000745614.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PQQ13_RS03975 (818962) | 818962..820695 | + | 1734 | WP_000813387.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16201.18 Da Isoelectric Point: 10.7537
>T271178 WP_001727955.1 NZ_CP117402:816223-816636 [Salmonella enterica subsp. enterica serovar Give]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMMLLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMMLLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I1G658 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0YWH4 |