Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3486838..3487458 | Replicon | chromosome |
Accession | NZ_CP117396 | ||
Organism | Salmonella enterica subsp. enterica serovar Uganda strain RM016 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PQP86_RS17285 | Protein ID | WP_001280991.1 |
Coordinates | 3487240..3487458 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | PQP86_RS17280 | Protein ID | WP_000344807.1 |
Coordinates | 3486838..3487212 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP86_RS17270 (3481977) | 3481977..3483170 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PQP86_RS17275 (3483193) | 3483193..3486342 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
PQP86_RS17280 (3486838) | 3486838..3487212 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
PQP86_RS17285 (3487240) | 3487240..3487458 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PQP86_RS17290 (3487637) | 3487637..3488188 | + | 552 | WP_001278791.1 | maltose O-acetyltransferase | - |
PQP86_RS17295 (3488306) | 3488306..3488776 | + | 471 | WP_000136183.1 | YlaC family protein | - |
PQP86_RS17300 (3488832) | 3488832..3488972 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PQP86_RS17305 (3488978) | 3488978..3489238 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PQP86_RS17310 (3489463) | 3489463..3491013 | + | 1551 | WP_076932570.1 | EAL domain-containing protein | - |
PQP86_RS17320 (3491244) | 3491244..3491633 | + | 390 | WP_000961285.1 | MGMT family protein | - |
PQP86_RS17325 (3491666) | 3491666..3492235 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T271125 WP_001280991.1 NZ_CP117396:3487240-3487458 [Salmonella enterica subsp. enterica serovar Uganda]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT271125 WP_000344807.1 NZ_CP117396:3486838-3487212 [Salmonella enterica subsp. enterica serovar Uganda]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|