Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2369439..2369961 | Replicon | chromosome |
Accession | NZ_CP117396 | ||
Organism | Salmonella enterica subsp. enterica serovar Uganda strain RM016 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | V7IL40 |
Locus tag | PQP86_RS11530 | Protein ID | WP_000221345.1 |
Coordinates | 2369677..2369961 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | PQP86_RS11525 | Protein ID | WP_000885424.1 |
Coordinates | 2369439..2369687 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP86_RS11500 (2365075) | 2365075..2365983 | - | 909 | WP_079798353.1 | LysR family transcriptional regulator | - |
PQP86_RS11505 (2366900) | 2366900..2367635 | + | 736 | Protein_2249 | helix-turn-helix domain-containing protein | - |
PQP86_RS11510 (2367691) | 2367691..2368599 | - | 909 | WP_079798383.1 | hypothetical protein | - |
PQP86_RS11515 (2368750) | 2368750..2369082 | - | 333 | WP_000253155.1 | DUF1493 family protein | - |
PQP86_RS11520 (2369072) | 2369072..2369287 | - | 216 | WP_000206206.1 | hypothetical protein | - |
PQP86_RS11525 (2369439) | 2369439..2369687 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PQP86_RS11530 (2369677) | 2369677..2369961 | + | 285 | WP_000221345.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PQP86_RS11535 (2370121) | 2370121..2370510 | + | 390 | WP_001652798.1 | RidA family protein | - |
PQP86_RS11540 (2370562) | 2370562..2371641 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
PQP86_RS11545 (2371834) | 2371834..2372322 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
PQP86_RS11550 (2372367) | 2372367..2373875 | + | 1509 | WP_079798354.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2362203..2376732 | 14529 | |
- | flank | IS/Tn | - | - | 2366900..2367469 | 569 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11043.79 Da Isoelectric Point: 10.6500
>T271124 WP_000221345.1 NZ_CP117396:2369677-2369961 [Salmonella enterica subsp. enterica serovar Uganda]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5Y2FFA8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |