Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4127698..4128479 | Replicon | chromosome |
Accession | NZ_CP117392 | ||
Organism | Salmonella enterica subsp. enterica serovar Give strain RM019 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A3V8KWJ7 |
Locus tag | PQQ03_RS20175 | Protein ID | WP_001609688.1 |
Coordinates | 4127698..4128189 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | A0A3V4SIN7 |
Locus tag | PQQ03_RS20180 | Protein ID | WP_001110453.1 |
Coordinates | 4128186..4128479 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ03_RS20150 (4122834) | 4122834..4125272 | - | 2439 | WP_001014136.1 | F4 (K88) fimbrial usher FaeD | - |
PQQ03_RS20155 (4125282) | 4125282..4125821 | - | 540 | WP_000721295.1 | type 1 fimbrial protein | - |
PQQ03_RS20160 (4125856) | 4125856..4126146 | - | 291 | WP_000773469.1 | PapB/FocB family fimbrial expression transcriptional regulator | - |
PQQ03_RS20165 (4126733) | 4126733..4126960 | + | 228 | WP_001112992.1 | hypothetical protein | - |
PQQ03_RS20170 (4127235) | 4127235..4127483 | - | 249 | Protein_3939 | IS481 family transposase | - |
PQQ03_RS20175 (4127698) | 4127698..4128189 | - | 492 | WP_001609688.1 | GNAT family N-acetyltransferase | Toxin |
PQQ03_RS20180 (4128186) | 4128186..4128479 | - | 294 | WP_001110453.1 | DUF1778 domain-containing protein | Antitoxin |
PQQ03_RS20185 (4128797) | 4128797..4129019 | + | 223 | Protein_3942 | hypothetical protein | - |
PQQ03_RS20190 (4129283) | 4129283..4130158 | + | 876 | WP_000921676.1 | AraC family transcriptional regulator | - |
PQQ03_RS20195 (4130155) | 4130155..4130442 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
PQQ03_RS20200 (4130435) | 4130435..4130617 | - | 183 | WP_001527266.1 | ATP-binding cassette domain-containing protein | - |
PQQ03_RS20205 (4130637) | 4130637..4130736 | + | 100 | Protein_3946 | hypothetical protein | - |
PQQ03_RS20210 (4130846) | 4130846..4130980 | + | 135 | Protein_3947 | hypothetical protein | - |
PQQ03_RS20215 (4131275) | 4131275..4132180 | - | 906 | WP_001268209.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | faeI / faeH / faeF / faeE / faeD / faeC | 4116077..4130617 | 14540 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17664.46 Da Isoelectric Point: 7.2655
>T271090 WP_001609688.1 NZ_CP117392:c4128189-4127698 [Salmonella enterica subsp. enterica serovar Give]
MISAPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSSVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVEETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISAPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSSVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVEETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10948.57 Da Isoelectric Point: 9.8590
>AT271090 WP_001110453.1 NZ_CP117392:c4128479-4128186 [Salmonella enterica subsp. enterica serovar Give]
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPQAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPQAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V8KWJ7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V4SIN7 |