Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 3989801..3990317 | Replicon | chromosome |
Accession | NZ_CP117392 | ||
Organism | Salmonella enterica subsp. enterica serovar Give strain RM019 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A5J2LRU5 |
Locus tag | PQQ03_RS19455 | Protein ID | WP_001609934.1 |
Coordinates | 3989801..3990085 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | PQQ03_RS19460 | Protein ID | WP_000212724.1 |
Coordinates | 3990075..3990317 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ03_RS19440 (3984917) | 3984917..3986569 | + | 1653 | WP_023212814.1 | alpha,alpha-phosphotrehalase | - |
PQQ03_RS19445 (3986978) | 3986978..3989116 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
PQQ03_RS19450 (3989333) | 3989333..3989797 | + | 465 | WP_017465840.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
PQQ03_RS19455 (3989801) | 3989801..3990085 | - | 285 | WP_001609934.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PQQ03_RS19460 (3990075) | 3990075..3990317 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PQQ03_RS19465 (3990395) | 3990395..3992308 | - | 1914 | WP_001609931.1 | BglG family transcription antiterminator | - |
PQQ03_RS19470 (3992325) | 3992325..3993065 | - | 741 | WP_023229489.1 | KDGP aldolase family protein | - |
PQQ03_RS19475 (3993062) | 3993062..3994180 | - | 1119 | WP_001139182.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
PQQ03_RS19480 (3994164) | 3994164..3995297 | - | 1134 | WP_001609909.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10859.66 Da Isoelectric Point: 9.3941
>T271089 WP_001609934.1 NZ_CP117392:c3990085-3989801 [Salmonella enterica subsp. enterica serovar Give]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSACLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSACLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5J2LRU5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |