Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 3949183..3949733 | Replicon | chromosome |
Accession | NZ_CP117392 | ||
Organism | Salmonella enterica subsp. enterica serovar Give strain RM019 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | M7RJ32 |
Locus tag | PQQ03_RS19255 | Protein ID | WP_001199743.1 |
Coordinates | 3949183..3949491 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | A0A3V9PUN9 |
Locus tag | PQQ03_RS19260 | Protein ID | WP_000016243.1 |
Coordinates | 3949494..3949733 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ03_RS19245 (3944583) | 3944583..3948098 | - | 3516 | WP_000342548.1 | AAA domain-containing protein | - |
PQQ03_RS19250 (3948460) | 3948460..3948761 | - | 302 | Protein_3760 | Arm DNA-binding domain-containing protein | - |
PQQ03_RS19255 (3949183) | 3949183..3949491 | - | 309 | WP_001199743.1 | CcdB family protein | Toxin |
PQQ03_RS19260 (3949494) | 3949494..3949733 | - | 240 | WP_000016243.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
PQQ03_RS19265 (3949842) | 3949842..3950066 | - | 225 | WP_031233173.1 | ribbon-helix-helix protein, CopG family | - |
PQQ03_RS19275 (3950851) | 3950851..3951870 | + | 1020 | WP_000152563.1 | NAD(P)-dependent alcohol dehydrogenase | - |
PQQ03_RS19280 (3951898) | 3951898..3952428 | - | 531 | WP_023231125.1 | gluconokinase | - |
PQQ03_RS19285 (3952645) | 3952645..3953676 | + | 1032 | WP_000453358.1 | L-idonate 5-dehydrogenase | - |
PQQ03_RS19290 (3953701) | 3953701..3954465 | + | 765 | WP_000998688.1 | gluconate 5-dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11845.67 Da Isoelectric Point: 6.7228
>T271088 WP_001199743.1 NZ_CP117392:c3949491-3949183 [Salmonella enterica subsp. enterica serovar Give]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6C6Z9V9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V9PUN9 |