Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3320680..3321300 | Replicon | chromosome |
Accession | NZ_CP117392 | ||
Organism | Salmonella enterica subsp. enterica serovar Give strain RM019 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PQQ03_RS16345 | Protein ID | WP_001280991.1 |
Coordinates | 3321082..3321300 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | PQQ03_RS16340 | Protein ID | WP_000344807.1 |
Coordinates | 3320680..3321054 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ03_RS16330 (3315819) | 3315819..3317012 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PQQ03_RS16335 (3317035) | 3317035..3320184 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
PQQ03_RS16340 (3320680) | 3320680..3321054 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
PQQ03_RS16345 (3321082) | 3321082..3321300 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PQQ03_RS16350 (3321479) | 3321479..3322030 | + | 552 | WP_001278791.1 | maltose O-acetyltransferase | - |
PQQ03_RS16355 (3322148) | 3322148..3322618 | + | 471 | WP_000136183.1 | YlaC family protein | - |
PQQ03_RS16360 (3322674) | 3322674..3322814 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PQQ03_RS16365 (3322820) | 3322820..3323080 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PQQ03_RS16370 (3323305) | 3323305..3324855 | + | 1551 | WP_023230872.1 | EAL domain-containing protein | - |
PQQ03_RS16380 (3325086) | 3325086..3325475 | + | 390 | WP_023230873.1 | MGMT family protein | - |
PQQ03_RS16385 (3325508) | 3325508..3326077 | - | 570 | WP_000779801.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T271087 WP_001280991.1 NZ_CP117392:3321082-3321300 [Salmonella enterica subsp. enterica serovar Give]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT271087 WP_000344807.1 NZ_CP117392:3320680-3321054 [Salmonella enterica subsp. enterica serovar Give]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|