Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4163701..4164217 | Replicon | chromosome |
Accession | NZ_CP117390 | ||
Organism | Salmonella enterica subsp. enterica serovar Uganda strain RM008 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A3V5VNJ7 |
Locus tag | PQP88_RS20270 | Protein ID | WP_000220577.1 |
Coordinates | 4163701..4163985 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | PQP88_RS20275 | Protein ID | WP_000212724.1 |
Coordinates | 4163975..4164217 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP88_RS20255 (4158817) | 4158817..4160469 | + | 1653 | WP_079798427.1 | alpha,alpha-phosphotrehalase | - |
PQP88_RS20260 (4160878) | 4160878..4163016 | + | 2139 | WP_000187821.1 | anaerobic ribonucleoside-triphosphate reductase | - |
PQP88_RS20265 (4163233) | 4163233..4163697 | + | 465 | WP_001009173.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
PQP88_RS20270 (4163701) | 4163701..4163985 | - | 285 | WP_000220577.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PQP88_RS20275 (4163975) | 4163975..4164217 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PQP88_RS20280 (4164295) | 4164295..4166208 | - | 1914 | WP_001212131.1 | BglG family transcription antiterminator | - |
PQP88_RS20285 (4166225) | 4166225..4166965 | - | 741 | WP_000779252.1 | KDGP aldolase family protein | - |
PQP88_RS20290 (4166962) | 4166962..4168080 | - | 1119 | WP_001139178.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
PQP88_RS20295 (4168064) | 4168064..4169197 | - | 1134 | WP_000459930.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10912.71 Da Isoelectric Point: 9.8739
>T271075 WP_000220577.1 NZ_CP117390:c4163985-4163701 [Salmonella enterica subsp. enterica serovar Uganda]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V5VNJ7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |