Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3447329..3447949 | Replicon | chromosome |
Accession | NZ_CP117390 | ||
Organism | Salmonella enterica subsp. enterica serovar Uganda strain RM008 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PQP88_RS16970 | Protein ID | WP_001280991.1 |
Coordinates | 3447731..3447949 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | PQP88_RS16965 | Protein ID | WP_000344807.1 |
Coordinates | 3447329..3447703 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP88_RS16955 (3442468) | 3442468..3443661 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PQP88_RS16960 (3443684) | 3443684..3446833 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
PQP88_RS16965 (3447329) | 3447329..3447703 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
PQP88_RS16970 (3447731) | 3447731..3447949 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PQP88_RS16975 (3448128) | 3448128..3448679 | + | 552 | WP_001278791.1 | maltose O-acetyltransferase | - |
PQP88_RS16980 (3448797) | 3448797..3449267 | + | 471 | WP_000136183.1 | YlaC family protein | - |
PQP88_RS16985 (3449323) | 3449323..3449463 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PQP88_RS16990 (3449469) | 3449469..3449729 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PQP88_RS16995 (3449954) | 3449954..3451504 | + | 1551 | WP_076932570.1 | EAL domain-containing protein | - |
PQP88_RS17005 (3451735) | 3451735..3452124 | + | 390 | WP_000961285.1 | MGMT family protein | - |
PQP88_RS17010 (3452157) | 3452157..3452726 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T271068 WP_001280991.1 NZ_CP117390:3447731-3447949 [Salmonella enterica subsp. enterica serovar Uganda]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT271068 WP_000344807.1 NZ_CP117390:3447329-3447703 [Salmonella enterica subsp. enterica serovar Uganda]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|