Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-YafN |
| Location | 2369473..2369995 | Replicon | chromosome |
| Accession | NZ_CP117390 | ||
| Organism | Salmonella enterica subsp. enterica serovar Uganda strain RM008 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | V7IL40 |
| Locus tag | PQP88_RS11535 | Protein ID | WP_000221345.1 |
| Coordinates | 2369711..2369995 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | V1H457 |
| Locus tag | PQP88_RS11530 | Protein ID | WP_000885424.1 |
| Coordinates | 2369473..2369721 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP88_RS11505 (2365109) | 2365109..2366017 | - | 909 | WP_079798353.1 | LysR family transcriptional regulator | - |
| PQP88_RS11510 (2366934) | 2366934..2367669 | + | 736 | Protein_2250 | helix-turn-helix domain-containing protein | - |
| PQP88_RS11515 (2367725) | 2367725..2368633 | - | 909 | WP_079798383.1 | hypothetical protein | - |
| PQP88_RS11520 (2368784) | 2368784..2369116 | - | 333 | WP_000253155.1 | DUF1493 family protein | - |
| PQP88_RS11525 (2369106) | 2369106..2369321 | - | 216 | WP_000206206.1 | hypothetical protein | - |
| PQP88_RS11530 (2369473) | 2369473..2369721 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PQP88_RS11535 (2369711) | 2369711..2369995 | + | 285 | WP_000221345.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PQP88_RS11540 (2370155) | 2370155..2370544 | + | 390 | WP_001652798.1 | RidA family protein | - |
| PQP88_RS11545 (2370596) | 2370596..2371675 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
| PQP88_RS11550 (2371868) | 2371868..2372356 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| PQP88_RS11555 (2372401) | 2372401..2373909 | + | 1509 | WP_079798354.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2362237..2376766 | 14529 | |
| - | flank | IS/Tn | - | - | 2366934..2367503 | 569 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11043.79 Da Isoelectric Point: 10.6500
>T271067 WP_000221345.1 NZ_CP117390:2369711-2369995 [Salmonella enterica subsp. enterica serovar Uganda]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5Y2FFA8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0WPN5 |