Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 849182..849807 | Replicon | chromosome |
| Accession | NZ_CP117390 | ||
| Organism | Salmonella enterica subsp. enterica serovar Uganda strain RM008 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PQP88_RS04175 | Protein ID | WP_274890525.1 |
| Coordinates | 849409..849807 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | C0PXM4 |
| Locus tag | PQP88_RS04170 | Protein ID | WP_000557545.1 |
| Coordinates | 849182..849409 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP88_RS04140 (844278) | 844278..845376 | + | 1099 | WP_010989230.1 | peptide chain release factor 2 | - |
| PQP88_RS04145 (845386) | 845386..846903 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
| PQP88_RS04150 (846979) | 846979..847524 | - | 546 | WP_050067887.1 | isopentenyl-diphosphate Delta-isomerase | - |
| PQP88_RS04155 (847789) | 847789..848547 | + | 759 | WP_000244328.1 | amidase activator ActS | - |
| PQP88_RS04165 (848793) | 848793..849005 | - | 213 | WP_024152440.1 | hypothetical protein | - |
| PQP88_RS04170 (849182) | 849182..849409 | + | 228 | WP_000557545.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| PQP88_RS04175 (849409) | 849409..849807 | + | 399 | WP_274890525.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| PQP88_RS04180 (850616) | 850616..851152 | + | 537 | WP_001038503.1 | STM3031 family outer membrane protein | - |
| PQP88_RS04185 (851199) | 851199..851831 | + | 633 | WP_000835265.1 | YfdX family protein | - |
| PQP88_RS04190 (852550) | 852550..853137 | + | 588 | WP_001244643.1 | fimbrial protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 848793..858955 | 10162 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15038.38 Da Isoelectric Point: 8.2817
>T271060 WP_274890525.1 NZ_CP117390:849409-849807 [Salmonella enterica subsp. enterica serovar Uganda]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSRAPERNLAGVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSRAPERNLAGVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|