Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 839454..840114 | Replicon | chromosome |
Accession | NZ_CP117390 | ||
Organism | Salmonella enterica subsp. enterica serovar Uganda strain RM008 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A5I5GR00 |
Locus tag | PQP88_RS04115 | Protein ID | WP_000244761.1 |
Coordinates | 839701..840114 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S5MU13 |
Locus tag | PQP88_RS04110 | Protein ID | WP_000351186.1 |
Coordinates | 839454..839720 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP88_RS04090 (835382) | 835382..836815 | - | 1434 | WP_001230140.1 | 6-phospho-beta-glucosidase BglA | - |
PQP88_RS04095 (836974) | 836974..837285 | + | 312 | WP_001182970.1 | N(4)-acetylcytidine aminohydrolase | - |
PQP88_RS04100 (837449) | 837449..838108 | + | 660 | WP_000250289.1 | hemolysin III family protein | - |
PQP88_RS04105 (838224) | 838224..839204 | - | 981 | WP_000874176.1 | tRNA-modifying protein YgfZ | - |
PQP88_RS04110 (839454) | 839454..839720 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
PQP88_RS04115 (839701) | 839701..840114 | + | 414 | WP_000244761.1 | protein YgfX | Toxin |
PQP88_RS04120 (840167) | 840167..840688 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
PQP88_RS04125 (840801) | 840801..841697 | + | 897 | WP_000434299.1 | site-specific tyrosine recombinase XerD | - |
PQP88_RS04130 (841721) | 841721..842434 | + | 714 | WP_000745615.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PQP88_RS04135 (842440) | 842440..844173 | + | 1734 | WP_000813394.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16199.15 Da Isoelectric Point: 10.7537
>T271059 WP_000244761.1 NZ_CP117390:839701-840114 [Salmonella enterica subsp. enterica serovar Uganda]
VVLWQSDLRVSWRAQWISLLIHGLVSAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVSAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I5GR00 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0YWH4 |