Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3486881..3487501 | Replicon | chromosome |
Accession | NZ_CP117388 | ||
Organism | Salmonella enterica subsp. enterica serovar Uganda strain RM010 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PQQ04_RS17290 | Protein ID | WP_001280991.1 |
Coordinates | 3487283..3487501 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | PQQ04_RS17285 | Protein ID | WP_000344807.1 |
Coordinates | 3486881..3487255 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ04_RS17275 (3482020) | 3482020..3483213 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PQQ04_RS17280 (3483236) | 3483236..3486385 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
PQQ04_RS17285 (3486881) | 3486881..3487255 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
PQQ04_RS17290 (3487283) | 3487283..3487501 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PQQ04_RS17295 (3487680) | 3487680..3488231 | + | 552 | WP_001278791.1 | maltose O-acetyltransferase | - |
PQQ04_RS17300 (3488349) | 3488349..3488819 | + | 471 | WP_000136183.1 | YlaC family protein | - |
PQQ04_RS17305 (3488875) | 3488875..3489015 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PQQ04_RS17310 (3489021) | 3489021..3489281 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PQQ04_RS17315 (3489506) | 3489506..3491056 | + | 1551 | WP_076932570.1 | EAL domain-containing protein | - |
PQQ04_RS17325 (3491287) | 3491287..3491676 | + | 390 | WP_000961285.1 | MGMT family protein | - |
PQQ04_RS17330 (3491709) | 3491709..3492278 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T271046 WP_001280991.1 NZ_CP117388:3487283-3487501 [Salmonella enterica subsp. enterica serovar Uganda]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT271046 WP_000344807.1 NZ_CP117388:3486881-3487255 [Salmonella enterica subsp. enterica serovar Uganda]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|