Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 839334..839994 | Replicon | chromosome |
| Accession | NZ_CP117388 | ||
| Organism | Salmonella enterica subsp. enterica serovar Uganda strain RM010 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A5I5GR00 |
| Locus tag | PQQ04_RS04115 | Protein ID | WP_000244761.1 |
| Coordinates | 839581..839994 (+) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S5MU13 |
| Locus tag | PQQ04_RS04110 | Protein ID | WP_000351186.1 |
| Coordinates | 839334..839600 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ04_RS04090 (835262) | 835262..836695 | - | 1434 | WP_001230140.1 | 6-phospho-beta-glucosidase BglA | - |
| PQQ04_RS04095 (836854) | 836854..837165 | + | 312 | WP_001182970.1 | N(4)-acetylcytidine aminohydrolase | - |
| PQQ04_RS04100 (837329) | 837329..837988 | + | 660 | WP_000250289.1 | hemolysin III family protein | - |
| PQQ04_RS04105 (838104) | 838104..839084 | - | 981 | WP_000874176.1 | tRNA-modifying protein YgfZ | - |
| PQQ04_RS04110 (839334) | 839334..839600 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
| PQQ04_RS04115 (839581) | 839581..839994 | + | 414 | WP_000244761.1 | protein YgfX | Toxin |
| PQQ04_RS04120 (840047) | 840047..840568 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
| PQQ04_RS04125 (840681) | 840681..841577 | + | 897 | WP_000434299.1 | site-specific tyrosine recombinase XerD | - |
| PQQ04_RS04130 (841601) | 841601..842314 | + | 714 | WP_000745615.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PQQ04_RS04135 (842320) | 842320..844053 | + | 1734 | WP_274895042.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16199.15 Da Isoelectric Point: 10.7537
>T271037 WP_000244761.1 NZ_CP117388:839581-839994 [Salmonella enterica subsp. enterica serovar Uganda]
VVLWQSDLRVSWRAQWISLLIHGLVSAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVSAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I5GR00 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0YWH4 |