Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4202766..4203282 | Replicon | chromosome |
Accession | NZ_CP117386 | ||
Organism | Salmonella enterica subsp. enterica serovar Uganda strain RM011 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A3V5VNJ7 |
Locus tag | PQP90_RS20600 | Protein ID | WP_000220577.1 |
Coordinates | 4202766..4203050 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | PQP90_RS20605 | Protein ID | WP_000212724.1 |
Coordinates | 4203040..4203282 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP90_RS20585 (4197882) | 4197882..4199534 | + | 1653 | WP_079798427.1 | alpha,alpha-phosphotrehalase | - |
PQP90_RS20590 (4199943) | 4199943..4202081 | + | 2139 | WP_000187821.1 | anaerobic ribonucleoside-triphosphate reductase | - |
PQP90_RS20595 (4202298) | 4202298..4202762 | + | 465 | WP_001009173.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
PQP90_RS20600 (4202766) | 4202766..4203050 | - | 285 | WP_000220577.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PQP90_RS20605 (4203040) | 4203040..4203282 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PQP90_RS20610 (4203360) | 4203360..4205273 | - | 1914 | WP_001212131.1 | BglG family transcription antiterminator | - |
PQP90_RS20615 (4205290) | 4205290..4206030 | - | 741 | WP_000779252.1 | KDGP aldolase family protein | - |
PQP90_RS20620 (4206027) | 4206027..4207145 | - | 1119 | WP_001139178.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
PQP90_RS20625 (4207129) | 4207129..4208262 | - | 1134 | WP_274897660.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10912.71 Da Isoelectric Point: 9.8739
>T271031 WP_000220577.1 NZ_CP117386:c4203050-4202766 [Salmonella enterica subsp. enterica serovar Uganda]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V5VNJ7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |