Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3486392..3487012 | Replicon | chromosome |
| Accession | NZ_CP117386 | ||
| Organism | Salmonella enterica subsp. enterica serovar Uganda strain RM011 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | PQP90_RS17300 | Protein ID | WP_001280991.1 |
| Coordinates | 3486794..3487012 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | PQP90_RS17295 | Protein ID | WP_000344807.1 |
| Coordinates | 3486392..3486766 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP90_RS17285 (3481531) | 3481531..3482724 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PQP90_RS17290 (3482747) | 3482747..3485896 | + | 3150 | WP_274897632.1 | efflux RND transporter permease AcrB | - |
| PQP90_RS17295 (3486392) | 3486392..3486766 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| PQP90_RS17300 (3486794) | 3486794..3487012 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| PQP90_RS17305 (3487191) | 3487191..3487742 | + | 552 | WP_001278791.1 | maltose O-acetyltransferase | - |
| PQP90_RS17310 (3487860) | 3487860..3488330 | + | 471 | WP_000136183.1 | YlaC family protein | - |
| PQP90_RS17315 (3488386) | 3488386..3488526 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| PQP90_RS17320 (3488532) | 3488532..3488792 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| PQP90_RS17325 (3489017) | 3489017..3490567 | + | 1551 | WP_076932570.1 | EAL domain-containing protein | - |
| PQP90_RS17335 (3490798) | 3490798..3491187 | + | 390 | WP_000961285.1 | MGMT family protein | - |
| PQP90_RS17340 (3491220) | 3491220..3491789 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T271024 WP_001280991.1 NZ_CP117386:3486794-3487012 [Salmonella enterica subsp. enterica serovar Uganda]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT271024 WP_000344807.1 NZ_CP117386:3486392-3486766 [Salmonella enterica subsp. enterica serovar Uganda]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|