Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2123275..2123797 | Replicon | chromosome |
Accession | NZ_CP117386 | ||
Organism | Salmonella enterica subsp. enterica serovar Uganda strain RM011 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | V7IL40 |
Locus tag | PQP90_RS10360 | Protein ID | WP_000221345.1 |
Coordinates | 2123275..2123559 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | PQP90_RS10365 | Protein ID | WP_000885424.1 |
Coordinates | 2123549..2123797 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP90_RS10340 (2119361) | 2119361..2120869 | - | 1509 | WP_079798354.1 | FAD-dependent oxidoreductase | - |
PQP90_RS10345 (2120914) | 2120914..2121402 | + | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
PQP90_RS10350 (2121595) | 2121595..2122674 | + | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
PQP90_RS10355 (2122726) | 2122726..2123115 | - | 390 | WP_001652798.1 | RidA family protein | - |
PQP90_RS10360 (2123275) | 2123275..2123559 | - | 285 | WP_000221345.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PQP90_RS10365 (2123549) | 2123549..2123797 | - | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PQP90_RS10370 (2123949) | 2123949..2124164 | + | 216 | WP_000206206.1 | hypothetical protein | - |
PQP90_RS10375 (2124154) | 2124154..2124486 | + | 333 | WP_000253155.1 | DUF1493 family protein | - |
PQP90_RS10380 (2124637) | 2124637..2125545 | + | 909 | WP_079798383.1 | hypothetical protein | - |
PQP90_RS10385 (2125601) | 2125601..2126336 | - | 736 | Protein_2031 | helix-turn-helix domain-containing protein | - |
PQP90_RS10390 (2127253) | 2127253..2128161 | + | 909 | WP_079798353.1 | LysR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2121595..2131033 | 9438 | |
- | flank | IS/Tn | - | - | 2125767..2126336 | 569 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11043.79 Da Isoelectric Point: 10.6500
>T271018 WP_000221345.1 NZ_CP117386:c2123559-2123275 [Salmonella enterica subsp. enterica serovar Uganda]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5Y2FFA8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |