Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 849034..849659 | Replicon | chromosome |
Accession | NZ_CP117386 | ||
Organism | Salmonella enterica subsp. enterica serovar Uganda strain RM011 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PQP90_RS04180 | Protein ID | WP_274897708.1 |
Coordinates | 849261..849659 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | C0PXM4 |
Locus tag | PQP90_RS04175 | Protein ID | WP_000557545.1 |
Coordinates | 849034..849261 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP90_RS04145 (844130) | 844130..845228 | + | 1099 | WP_274897707.1 | peptide chain release factor 2 | - |
PQP90_RS04150 (845238) | 845238..846755 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
PQP90_RS04155 (846831) | 846831..847376 | - | 546 | WP_050067887.1 | isopentenyl-diphosphate Delta-isomerase | - |
PQP90_RS04160 (847641) | 847641..848399 | + | 759 | WP_000244328.1 | amidase activator ActS | - |
PQP90_RS04170 (848645) | 848645..848857 | - | 213 | WP_024152440.1 | hypothetical protein | - |
PQP90_RS04175 (849034) | 849034..849261 | + | 228 | WP_000557545.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
PQP90_RS04180 (849261) | 849261..849659 | + | 399 | WP_274897708.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
PQP90_RS04185 (850468) | 850468..851004 | + | 537 | WP_001038503.1 | STM3031 family outer membrane protein | - |
PQP90_RS04190 (851051) | 851051..851683 | + | 633 | WP_000835265.1 | YfdX family protein | - |
PQP90_RS04195 (852402) | 852402..852989 | + | 588 | WP_001244643.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 849034..858807 | 9773 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15009.38 Da Isoelectric Point: 7.7785
>T271016 WP_274897708.1 NZ_CP117386:849261-849659 [Salmonella enterica subsp. enterica serovar Uganda]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAAVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAAVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|