Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3487042..3487662 | Replicon | chromosome |
Accession | NZ_CP117384 | ||
Organism | Salmonella enterica subsp. enterica serovar Uganda strain RM013 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PQP89_RS17285 | Protein ID | WP_001280991.1 |
Coordinates | 3487444..3487662 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | PQP89_RS17280 | Protein ID | WP_000344807.1 |
Coordinates | 3487042..3487416 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP89_RS17270 (3482181) | 3482181..3483374 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PQP89_RS17275 (3483397) | 3483397..3486546 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
PQP89_RS17280 (3487042) | 3487042..3487416 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
PQP89_RS17285 (3487444) | 3487444..3487662 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PQP89_RS17290 (3487841) | 3487841..3488392 | + | 552 | WP_001278791.1 | maltose O-acetyltransferase | - |
PQP89_RS17295 (3488510) | 3488510..3488980 | + | 471 | WP_000136183.1 | YlaC family protein | - |
PQP89_RS17300 (3489036) | 3489036..3489176 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PQP89_RS17305 (3489182) | 3489182..3489442 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PQP89_RS17310 (3489667) | 3489667..3491217 | + | 1551 | WP_076932570.1 | EAL domain-containing protein | - |
PQP89_RS17320 (3491448) | 3491448..3491837 | + | 390 | WP_000961285.1 | MGMT family protein | - |
PQP89_RS17325 (3491870) | 3491870..3492439 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T271002 WP_001280991.1 NZ_CP117384:3487444-3487662 [Salmonella enterica subsp. enterica serovar Uganda]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT271002 WP_000344807.1 NZ_CP117384:3487042-3487416 [Salmonella enterica subsp. enterica serovar Uganda]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|