Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4203035..4203551 | Replicon | chromosome |
| Accession | NZ_CP117382 | ||
| Organism | Salmonella enterica subsp. enterica serovar Uganda strain RM018 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A3V5VNJ7 |
| Locus tag | PQP98_RS20580 | Protein ID | WP_000220577.1 |
| Coordinates | 4203035..4203319 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | PQP98_RS20585 | Protein ID | WP_000212724.1 |
| Coordinates | 4203309..4203551 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP98_RS20565 (4198151) | 4198151..4199803 | + | 1653 | WP_079798427.1 | alpha,alpha-phosphotrehalase | - |
| PQP98_RS20570 (4200212) | 4200212..4202350 | + | 2139 | WP_000187821.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| PQP98_RS20575 (4202567) | 4202567..4203031 | + | 465 | WP_001009173.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| PQP98_RS20580 (4203035) | 4203035..4203319 | - | 285 | WP_000220577.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PQP98_RS20585 (4203309) | 4203309..4203551 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PQP98_RS20590 (4203629) | 4203629..4205542 | - | 1914 | WP_274877672.1 | BglG family transcription antiterminator | - |
| PQP98_RS20595 (4205559) | 4205559..4206299 | - | 741 | WP_000779252.1 | KDGP aldolase family protein | - |
| PQP98_RS20600 (4206296) | 4206296..4207414 | - | 1119 | WP_001139178.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| PQP98_RS20605 (4207398) | 4207398..4208531 | - | 1134 | WP_000459930.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10912.71 Da Isoelectric Point: 9.8739
>T270987 WP_000220577.1 NZ_CP117382:c4203319-4203035 [Salmonella enterica subsp. enterica serovar Uganda]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3V5VNJ7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |